KEGG   Xiphophorus maculatus (southern platyfish): 102230764Help
Entry
102230764         CDS       T02923                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like isoform X1
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102230764
   04020 Calcium signaling pathway
    102230764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xma04040]
    102230764
Ion channels [BR:xma04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102230764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel TMEM208_SND2 ETRAMP
Motif
Other DBs
NCBI-GeneID: 102230764
NCBI-ProteinID: XP_023204638
Ensembl: ENSXMAG00000012146
Position
16
AA seq 2350 aa AA seqDB search
MTSEECPVPLRSISSARPGQSEEYGSAHIDDIIEEVGPGDDNVSIGSDLSTLVLPFPELA
PVVFFCLKQTTCPRNWCIRMVSSPWFERISIMVILLNCVTLGMYQPCENIDCTSDRCQIL
QAFDAFIYIFFALEMVVKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLS
AIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLL
RNRCYQEENFTIPSGMTLPAPYYRPEEDDERPFICSLASDNGIMSCSDVPARREGGRVCC
LDKEDALHRQSLGLSPEPLSNGSGAGEALGLCINWNQYYTRCHTGSTNPHKGAINFDNIV
YAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIIGSFFMINLCLVVIATQFSET
KQREHQLMQEQRAQCLSSSTLASMAEPGDCYEELFQLVCHVLRKAKRRSAALYYTLRGKP
APTSIGRGNRRGGGNVNGDRHHLRHQRSPKCPHHGKQNHDSQAQANSISLTVQSPEECPI
CLKEGSRSAGQENGEENEEDAVKETDKEENHLEEKKNEERRQRRTCFGRCRDLWKDMRRK
LWGIVESKYFSRGIMIAILINTISMGIEHHNQPEELTNVLEICNIVFTSMFTLEMILKLS
AFGFFEYLRNPYNIFDGIIVIISVCEIIGQADGGLSVLRTFRLLRVIKLVRFMPALRRQL
VVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTEAGDTVPDRKNFDSLLWAIV
TVFQILTQEDWNMVLYNGMASTSPCAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDAN
RSYSDDDRSSCNFDENDKQKDSLHLSDPKICTLTPNGHLDMSLLPAGLFPGEKLTFALGS
RKNSVISLGRADLERRAAYPGRGYHNWGRPLPPQPHPLWARRSSWSSLGGRPCSSSSPSA
SPAFTPPSARPFYGYGLGGLGGMVGGSLRIRGPRASSSPHHHHHIQPDEEESLLSPPAAA
PHCLQLPHPKLHDYFVPRRDRRALSLELPHMLQSPAGNPQQHHALPPVKLHAHHRKKSLS
GGLVISTGGDLEGIHQDCNGKTPLSHLLLPPSRRQTEQTGGVNLQSHLMTDVFPQVNTRS
KDREDLDDDIEYSLCFRIQKMLEAYRPDWCETREDWSIFLFSPQNKFRQVCQSIIAHKLF
DYVVLAFIFSNCITVALERPKILQGSLERVFLTISNYIFTAIFVGEMTLKVVSMGLYMGE
QAYLRSSWNILDGFLVFVSLIDIVVSMAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKL
VVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKGKFFYCLGPDVKNITNKSDCLDKKY
KWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYHGLDAVGVDQQPITNNNPWMLLYFISF
LLIVSFFVLNMFVGVVVENFHKCRQHQEVEEAKRREEKRQRRMEKKRRKAQKLPYYSSYG
NMRLMIHTLCTNHYLDLIITFIICINVITMSLEHYNQPRSLDLALKYCNYFFTSTFVLES
ILKLIAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEISAALPINPTIIRIMRVLRIAR
VLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGELVCNEDYPCEG
MSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRECPPNHDSGVDYGCNPSLQFISPMY
FVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEEAEMDAEIELELAQGTLCCMGAPSCGG
LGVDKGLLTVGSGLGAAPGRRERGGGARGETGEGGRRLRHPVTNQGPYNSCDSPQSYSPA
QESQWLDSVSLLIKDTIDGEMLMIDNLSGSVFHHYSSPPVCKDCKGHPQEQIRMAEIEQA
SLKSEQLSDKSSSPALPDDLSLDEHTSYILLMQDGKGRCSSSSHNSDEADGGGGGHGGGH
QTEEQGQGQGASLQCRASSSDTETETELQEMEMQTYHTKMCSPLCSPGGISSISSKDRGK
GDEEKGASGISTLFHLPAEFFHSAGAAIPVPSRSRSLRLSRGLRLTSPASWVSFRSPGAP
RKMLCAQYPSHSDSSLATGSSEGSLQTTLEEGLSFSVSPSQNLELPIPTASLSPMCPISQ
PEDRITISSPLQALKPRVNPPSSVTLLATRGHQRSQSSGRGSTSPGYNRDDSIDPSDEDL
GIGIGSSIGGCGSSQAGNSEHLSEALSSMSLTSLLPPSTILCPGGQVKKCNSTGSLDKGG
LLLSSRCREGRREIMGMELMDPQGFLANPWTGVLGDSRRGEGTGVIKDAEHSLKGKSSSQ
TTVGSCRKNR
NT seq 7053 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtgaggagtgtcctgtgccgctgaggagtatctcctcagcacggccggggcag
agcgaggaatatggctcagcacacatagatgacatcattgaggaagtaggtccgggcgat
gacaacgtcagcatcggcagcgacttaagcacgcttgtgctgcccttccctgagttggcg
cctgtggtcttcttctgcctcaagcagacgacctgtcctcgcaactggtgcattcgcatg
gtctccagcccgtggttcgagaggattagcatcatggtgatcctgctcaactgtgtgacg
cttggcatgtaccagccctgcgagaacattgactgcacctcggaccgctgtcagatactc
caggccttcgatgcatttatctacatcttctttgcattggagatggtggtaaagatggtg
gctcttgggatctttggccgtcgctgttacttgggagatacctggaacaggctggatttt
ttcatcgtcatggctgggatggtggagtactccctggacctgcaaaacatcaacttgtct
gccattcgcacggttcgggttcttcggcccctgaaagccatcaacagagtcccaagtatg
cgcattctggtgaacctgctgctagacactctccccatgctgggcaatgtgctgcttctc
tgcttcttcgtcttcttcatcttcggcatcatcggcgtgcagttatgggcgggactcctg
aggaaccgatgctaccaagaggagaacttcaccataccttcaggcatgacgctgccagct
ccttactaccgaccagaagaggatgatgagcggcccttcatctgctccctggcttctgat
aacggcatcatgtcatgctctgatgtaccagcgcggcgggaaggaggacgcgtatgttgt
ctggataaggaagacgctctgcacagacagtctctgggcctgagtcctgagccactgtcg
aatggcagcggcgctggtgaagctctgggtctgtgcatcaactggaaccagtattataca
cggtgccatactggaagcactaacccccacaaaggagcaattaactttgacaacattgtg
tatgcctggattgtcattttccaggtgataacattagagggctgggtggagatcatgtat
tatgtgatggatgctcactccttttacaacttcatctacttcatccttctcatcattatt
ggttcattcttcatgatcaacctgtgcctggtggtcatcgccactcaattctcagagacc
aaacaacgggagcaccagctgatgcaggagcaaagagcgcagtgcctgtcctcttccacc
ttagccagcatggctgaaccaggagactgctatgaagagctcttccagctggtctgtcac
gtccttcgtaaggccaagaggagatcagcagctctctactacactctaagaggcaagcct
gctccaaccagtataggcaggggcaacaggcgagggggagggaatgtcaatggagatcgg
catcatttgaggcaccaaagatcacccaaatgtccacaccatggcaagcagaaccatgac
tcccaagctcaagctaactccatcagcctgactgtccagagccctgaggagtgccctatc
tgtttgaaggaaggttcgaggtctgcaggacaggagaatggggaagaaaatgaagaggat
gccgtgaaggaaacagacaaagaggagaaccacttagaggagaagaaaaatgaggagagg
aggcaaaggaggacgtgttttggacgttgtagggacctttggaaggatatgagaaggaaa
ctttggggtattgtggagagcaagtacttcagcaggggcattatgattgcaattcttatc
aacaccatcagcatgggcattgaacaccacaaccagcccgaggaactgaccaatgtcctg
gaaatctgtaacattgtcttcaccagcatgtttaccctggagatgatcctaaagctctca
gcttttggcttttttgagtacttgaggaacccatacaacatctttgatggcattattgtc
atcatcagtgtgtgtgagatcattggtcaggcagatggtggtctgtcagtgctgaggacg
ttcaggctgctgagggtcattaagctggtgaggttcatgcctgcactgagaaggcagctt
gtggtcctgatgaagaccatggacaatgtggccaccttctgcatgctgctcatgctcttc
atattcatcttcagtatcttggggatgcatatatttggctgtaagttcagtttgaagaca
gaggcaggagatacggttcctgacagaaagaactttgactccttgctttgggctatcgtc
actgtatttcagattctaactcaggaggactggaacatggttctctacaatggcatggcg
tccacctctccctgtgccgctctttacttcgtcgcccttatgacatttgggaactacgtg
ctcttcaatttactcgtcgccattttggttgaaggttttcaagcagagggtgacgcaaat
cgctcctattcggatgatgacaggtcctcctgtaattttgacgaaaatgataagcaaaaa
gactcccttcacctctcagacccaaagatctgtaccctgacccctaacggacacctggac
atgtcattgttgcctgctggtctgtttccaggagagaagttgacctttgcactcggctcc
agaaagaacagtgttatttctctcggcagagctgacctggagaggagggctgcgtatcca
ggtcgaggttaccacaactggggccgtccgctgcctccccagcctcaccccttgtgggcc
cgtcgctccagctggagcagccttgggggccgaccctgctcctcctcatctccctctgcc
agccctgccttcacgcctccgtctgcaaggcctttttacggctacggtctggggggtctc
ggagggatggtagggggaagcctccgtatccgcggccctcgtgcctcctcgtctccccac
catcaccatcatatccagccagatgaagaggagtcccttctctctccacctgctgccgct
cctcattgtcttcagctgccgcatccgaagctccatgactattttgtacctcgtcgggac
cgcagagctctctccctagagctcccacacatgctccagtctccagctggaaacccacag
caacatcatgctctccctcccgtgaaactccatgctcaccacaggaaaaagagcctctct
ggagggcttgtgatcagcaccggtggggacttggaaggaatccaccaagactgtaatggg
aagacgccactgtcgcacctgctccttccaccctcaaggcggcagacggagcagaccgga
ggggtgaacctccagagccacctgatgacggatgtcttcccccaggtcaacacacgcagc
aaggacagggaggacctggatgacgacattgaatatagcttatgcttccgaatccagaag
atgttggaggcatacagaccagactggtgtgagacgagagaagactggtccatctttctc
ttctctccgcagaacaagttcagacaggtgtgccagtccatcatcgcccataagctgttt
gactatgttgtgttggctttcatcttctccaactgcatcacagtggctcttgagaggcca
aagatccttcaaggcagcttggaaagagtctttctcaccatttccaactacatctttact
gccatctttgtgggcgagatgactctcaaggtggtttccatgggactgtatatgggcgag
caggcttatctgcggagcagctggaacattctggatggattcctggtttttgtgtcgttg
attgatattgttgtgtccatggcgggaggggcgaaaatcttgggcgtgctcagagtactg
agattgctacgaacgttgcgtcccctcagagtgataagcagagctccaggattgaagctg
gtggtggagacgctcatcacttccctcaagcctatcggcaacatcgtccttatctgttgc
gcattctttatcatctttggtatccttggcgtacagctttttaaaggcaaatttttctac
tgtctcggccctgatgtcaaaaacatcactaacaagtcagattgtctggacaaaaagtac
aagtgggtccaccataagtacaactttgataacttaggacaggcactgatgtctctgttc
gtacttgcctctaaagacggctgggtaaatatcatgtaccatggcctggatgcagtgggt
gttgatcaacagccaataaccaacaacaacccatggatgcttctgtacttcatttccttc
ctcctcatcgtcagcttctttgtcctcaacatgtttgttggtgtggtggtggaaaacttc
cacaagtgtcgccagcatcaagaagtggaggaggccaagagacgtgaggagaaacgacaa
cggcggatggaaaaaaagaggaggaaagctcagaagctaccttactactccagctacggc
aatatgcgcctgatgatccacacactctgcacaaaccactacctggatctcatcatcacc
ttcatcatctgtataaatgtcatcacgatgtcattagagcactacaatcaacctcgctcc
ctggaccttgcactaaagtactgcaactatttctttacctctacatttgtgttggagtcc
attctcaagctcatcgcatttggattccggcgcttcttcaaagacaggtggaatcagctg
gacctcgccattgttctcttgtcagtaatgggcatcactctggaggaaattgagatcagc
gccgctctgcccatcaaccccaccataatcagaatcatgagggttctgaggatagcacga
gtgttgaagctgctgaagatggcaaccggaatgagagccttattggatacagttgttcaa
gccctgcctcaggtgggtaacctgggcctgctcttcatgctgctgtttttcatctacgcc
gccttaggagtagagctttttggagaacttgtttgcaatgaagactatccatgtgaaggt
atgagtcgtcatgctacctttgaaaactttggcatggccttcctgaccttgtttcaagtc
tccacgggcgacaactggaatggcatcatgaaggacacattgcgggagtgcccaccaaac
catgactccggtgtggactatggctgcaatccgagccttcagtttatctcgcccatgtat
tttgtctcctttgtgctcaccgcccagtttgtgctcatcaatgtggtggtggccgtgctg
atgaagcacctggacgactccaacaaggaggcccaagaggaggcggagatggatgcagaa
attgagctggagctggcccagggcaccctctgttgcatgggcgcccccagttgtgggggt
ttgggggttgacaaaggacttttgactgttggatcggggcttggagctgcgccagggaga
agggagaggggcggaggtgccagaggcgagacgggggaaggagggaggaggttgcgacat
cccgtaacaaaccagggaccttacaattcctgtgattctcctcagtcatattcgccagca
caagagagccagtggttggacagcgtatctctcctaatcaaggatacaatagatggggag
atgctgatgatcgacaacctctccggctccgtcttccaccattactcctctccgcctgtc
tgcaaagactgcaagggccacccgcaagagcagatcagaatggcagagattgagcaggca
tcactgaagtcggagcaactctcagataagtcctcgtctcctgctctccctgacgacctg
agcctggacgaacataccagctacatactgctgatgcaagacgggaagggaaggtgcagc
agtagctcccataactctgatgaggccgatggtggaggaggcggccatggaggtggtcat
cagactgaggaacaaggtcaaggtcagggggcttccctgcaatgcagggcttccagctcg
gacacagagacagagactgaactgcaagagatggaaatgcaaacataccacacaaagatg
tgctcacctctctgctcccctggtgggatttccagcatcagcagcaaggacagaggcaaa
ggagacgaggaaaagggggccagtggcatttctaccctctttcatctgcctgctgagttt
ttccactctgcaggagcagccatcccggtaccttcacgcagtcggagcctgcgtttgtca
agaggcctcaggctgacctccccagcctcttgggtctcattccgctcccctggagcccct
cgaaagatgctctgtgcacaatacccatcccacagtgactcgtcccttgccactggtagc
tctgaaggcagcctccagacaaccctggaagaaggactgagcttcagtgtttctccatcg
cagaacctggaattgccaattccaacagcttccttatcacccatgtgccctatctcacag
cctgaagacagaattactatttcctctccacttcaggccctaaagcctagggtgaaccct
ccatcttctgtaacccttctggccaccaggggacaccaacggagccagagcagtggacga
ggcagcacaagccccggctacaatcgtgacgactccattgacccgtcagatgaagacttg
ggaataggcattggctcgtctatcggtggttgtggctccagccaagcgggcaacagtgaa
catttatcagaggcgctgagcagcatgtcactgacatctttgctgccgcctagcaccatc
ctatgccctggaggacaagtaaagaagtgcaacagcacaggtagccttgacaaggggggt
cttctgctgtcttcccggtgcagggaaggccgcagggaaattatgggaatggagctaatg
gacccccagggctttttggccaacccttggacaggagtactaggtgacagcagaagagga
gagggaactggagtaataaaagatgcagagcacagcttgaaagggaagagctcaagccaa
acaacagtggggtcttgtcgaaaaaatagatga

DBGET integrated database retrieval system