KEGG   Xiphophorus maculatus (southern platyfish): 102230777Help
Entry
102230777         CDS       T02923                                 

Gene name
nat1
Definition
(RefSeq) arylamine N-acetyltransferase 1 isoform X2
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00232  Caffeine metabolism
xma00983  Drug metabolism - other enzymes
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102230777 (nat1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102230777 (nat1)
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     102230777 (nat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 102230777
NCBI-ProteinID: XP_005796180
Position
4
AA seq 290 aa AA seqDB search
MNLEEYFQRIGFHGPSDKMDLATLKSIHKLHVMSIPFENLSVHCGEWITMDLETIFNKVV
RSSRGGWCLENNYLFGWVLRKMGFNSTMLGGRVFNTITNDFPPGENHLINKVIIDGKAYI
ADVSFGVSSQIWEPLELISGKDQPQAAGVFRLTKKEDTWILEKTGRTPKVLNPEFAKSSL
VNRKQTYQIFCFTLQPREPEHFAEKSHTLQTNPASLFTNKSICSLQTPTGFKALIGWTYS
EVTYKPEEGVDLLDMRNITEDELDQILKEQFNVKTQNKMKPANKKVSYTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggaggagtacttccaaagaataggcttccatggcccttctgataaaatggat
ctcgcaactttgaagtccatccacaagctgcatgtcatgtcgatcccttttgaaaacctc
agcgttcattgtggagagtggatcaccatggacctggagactattttcaataaggtggtg
aggagcagtcgtggaggctggtgccttgagaacaactacctgtttggatgggtgctgaga
aaaatgggcttcaattccacaatgttgggtggcagagttttcaacactatcaccaatgac
tttccacctggggagaatcatctcatcaacaaggttatcattgatgggaaggcttatata
gcagatgtaagctttggggtctcgtctcagatctgggagccactggagctcatctctgga
aaggaccaaccgcaggcagcaggcgtgtttcgacttaccaaaaaggaggacacgtggatc
ctggagaagacaggcaggacaccaaaggttctcaatccagaatttgccaaatccagcctg
gtgaacaggaagcaaacatatcagatcttctgcttcaccttgcagcctcgagagccagaa
cattttgcagaaaaaagccacacacttcaaacaaatccagcctctctgttcactaacaag
tccatctgctcgctgcaaacaccgacaggattcaaagctctgattggctggacctacagt
gaggtcacctacaaacctgaggaaggggtggatttgttggatatgagaaacataactgag
gatgagcttgatcaaatcctgaaggagcagtttaatgtaaagacacagaataaaatgaag
cctgcaaacaaaaaggtgtcctacacaatctag

DBGET integrated database retrieval system