KEGG   Xiphophorus maculatus (southern platyfish): 102231095Help
Entry
102231095         CDS       T02923                                 

Definition
(RefSeq) ankyrin repeat and SOCS box protein 13-like isoform X1
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xma04121]
    102231095
Ubiquitin system [BR:xma04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102231095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_2 Ank Ank_5 Ank_3 SOCS_box
Motif
Other DBs
NCBI-GeneID: 102231095
NCBI-ProteinID: XP_005808197
Ensembl: ENSXMAG00000005184
UniProt: M3ZSK0
Position
17
AA seq 280 aa AA seqDB search
MEIEISQPYYVGDIGCWAERTEVHKAASLGHASHLQHLIEGGASVNMVAVDSITPLHEAC
LRGQARCVQLLLDAGAQVDARNVDGSTPLCDACSAGSLECVKLLLERGAMANPALTSRTA
SPLHEACMGGNSDCVKLLIAMGACLEAYDLYYGTPLHVACVNAHTECVKVLLNAGAKVNS
ARLHETPLHHAAKHMRVEMIEVLVEFGANIYARDQHNRKPVDYTTPGSPSEACLQFYETI
PMTLQQLSRLAVRRKLGTTSLNVIAQLDMPKLIISYLCYQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagagatttctcagccgtattacgttggggacattggctgctgggcggagaga
acggaggtgcataaggcagcgtctctcggccacgcctcccacttgcagcacctcatagag
ggcggagcttcggtcaacatggtggcggtggactccatcactccgctgcacgaggcctgc
ctccggggacaggcccgctgtgtgcagctgctgctggacgctggagcccaggtggatgcc
aggaacgtggatggaagcacgccgttgtgtgacgcctgttcagctggtagtctggagtgt
gtgaagctgctgctggagcgtggagccatggccaacccggccctcacctcccgcaccgcc
tccccacttcatgaggcctgcatgggaggtaactcagactgtgtgaagctgctgattgcc
atgggtgcttgcctggaagcgtatgatctttactacggaactccgctacatgtggcctgt
gttaatgcacacacagagtgtgttaaagttctgcttaatgcaggtgctaaagtcaattct
gctaggctacatgagacccctctgcaccacgcagctaaacacatgagagttgaaatgatt
gaggttcttgtagagtttggagccaacatctacgctagagatcagcacaacaggaaaccg
gtggactacaccacacctggctctccttctgaggcctgtctgcagttttatgagaccatc
cccatgactctgcagcagctcagcaggttggcagtgaggaggaagttgggaacaacatct
ctgaacgtcatagctcaacttgacatgccaaagctaatcatcagctacctctgctatcag
tga

DBGET integrated database retrieval system