KEGG   Xiphophorus maculatus (southern platyfish): 102231732Help
Entry
102231732         CDS       T02923                                 

Gene name
nit1
Definition
(RefSeq) deaminated glutathione amidase isoform X1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102231732 (nit1)
Enzymes [BR:xma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     102231732 (nit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 102231732
NCBI-ProteinID: XP_023201660
Ensembl: ENSXMAG00000014690
Position
14
AA seq 318 aa AA seqDB search
MFRCNLGSSVKYVAFLSALGRHHILQNRMSTSPNPVAAVCQVTATPDKESNFSACKQLLE
EARQRGACMVFLPEGFDYIGSSREETLSMSEPLGGDIISRYTQLARKLDVWLSLGGFHER
GHDWENDRRIYNSHVIINNKGDVLSVYRKSHLFDVELPEKGVSLKESAFTIPGASLVPPV
QTPIGKVGLGVCYDLRFPELSLALQRHGADILTYPSAFTVVTGAAHWEVLLRARAIETQC
FVLAAAQVGRHHETRSSYGHALAVDPWGEVVGDCGGEKPGMVLVEVNLDKVNRTRKNMPV
QQHRRDSAFYHSLSQTCL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggtgcaacttaggatcatctgtgaagtacgtggcctttctatcagctctggga
cgccatcacatcctgcaaaacaggatgtccacttcgccgaacccagtagctgcagtctgt
caagttacggcaaccccagacaaggagtccaacttctctgcctgtaaacagctgctggag
gaagccaggcagcgaggggcctgcatggtgttcctgccagagggatttgactacattgga
tccagcagagaggagacactgtcaatgtcagagcctctgggaggggacataatctcccga
tacactcaacttgccaggaagttggatgtgtggctgtctctaggaggatttcatgaacga
ggacacgactgggagaacgacagacgtatttataacagccatgttatcattaataacaaa
ggtgacgtcctgtcagtctacagaaagtcccatttgtttgatgtggagctgccggaaaaa
ggtgtgtcactcaaagagagtgccttcaccatacccggagcctccctggttcctccagtc
cagactccaattggcaaggtcggactcggcgtctgctatgatttgaggttccctgagtta
tcgcttgctttgcaaagacatggtgcagatatccttacgtatccatctgctttcacggta
gtaacaggagctgctcactgggaggtgttactccgtgcccgggcaatagaaacgcagtgc
tttgtcctggcagctgcgcaggttggccggcaccacgaaacgcgttcgtcctacggccac
gccttggccgtcgacccctggggggaagtggtgggtgactgtggaggggagaagccaggc
atggtgctggtggaggtcaacctggacaaagtcaataggaccaggaagaacatgcctgtc
caacagcaccgcagggactctgctttttaccacagtttgagtcaaacctgtttgtga

DBGET integrated database retrieval system