KEGG   Xiphophorus maculatus (southern platyfish): 102231789Help
Entry
102231789         CDS       T02923                                 

Gene name
nlk
Definition
(RefSeq) serine/threonine-protein kinase NLK
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04068  FoxO signaling pathway
xma04310  Wnt signaling pathway
xma04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102231789 (nlk)
   04310 Wnt signaling pathway
    102231789 (nlk)
   04068 FoxO signaling pathway
    102231789 (nlk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102231789 (nlk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102231789 (nlk)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102231789 (nlk)
Protein kinases [BR:xma01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102231789 (nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Pkinase_fungal Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 102231789
NCBI-ProteinID: XP_005807535
Ensembl: ENSXMAG00000012171
UniProt: M4ACN3
Position
18
AA seq 526 aa AA seqDB search
MALCSTTATNVPKMMTAYNGGSSAVAAHHHHQLQHLPPPHMHHHHHHQAGQHHLQHPGSA
AAVRTVQQHTATAAAAAVMLNPGQQQPYFPSPAPGQAPGPASAAAPAQVQAAAVKSHHHH
HHQQQQNTHHLQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKR
VFRELKMLCFFKHENVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHA
KVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEV
VTQYYRAPEILMGSRHYSNSIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPS
MEAMRTACEGARAHILRGTHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDA
LAHPYLDEGRLRYHTCMCKCCYTTSSGRVYTSDFEPVTNSKFDDGFEKNLTSVRQVKEII
HQFILEQQKGSRVALCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggctctttgcagcacaactgccacaaacgttccaaaaatgatgactgcttacaacggt
ggctcctcagcagtggctgcccatcaccatcaccagctgcagcatctccctcctccccac
atgcaccatcaccaccaccaccaagcaggacagcatcacttgcagcacccgggttccgct
gcagcggtgcgcacggtgcagcagcacacagccactgctgcggctgcagcggtgatgctc
aatcctggccagcagcagccctacttcccctctcctgcgcctggacaggctccaggacct
gcttcagctgcagctccagcccaggttcaagccgctgctgtcaagtctcaccaccaccac
caccatcagcagcagcaaaacacgcatcaccttcagcagcagctggacatagagcctgat
cggcccattggctacggtgcgtttggagtcgtctggtcggtgacggatcccagagatgga
aagcgagtggctctcaaaaagatgcccaatgtcttccagaatcttgtttcttgcaaaagg
gtctttcgggaactgaagatgttgtgtttcttcaaacatgaaaatgtactttctgctttg
gacatactgcagcctccacacatcgactactttgaagaaatctatgttgtgactgaactt
atgcaaagtgacctccataagatcattgtatcaccacagcctctgagctcagatcatgcc
aaagtttttctgtatcagattcttcggggacttaaatacctgcactctgctggaattctg
caccgagacatcaaacctggcaacctcctggtcaacagcaactgtgtgctcaagatctgt
gattttgggctcgcccgtgtggaggagttggatgagtcccggcacatgactcaggaagtt
gtgacgcagtactacagagcaccagagatccttatgggcagccggcactactccaactcc
atcgatatttggtctgtgggctgcatctttgcagagctgctgggtcggcgcatcctcttc
caagctcaaagtcccattcagcagctggatttaatcactgacctactggggacgccttct
atggaggcaatgaggacagcatgtgaaggcgcacgggcgcacattctcagaggaactcat
aagcagccatccctccctgttctgtacacactgtctagccaggcaacccacgaagcagtt
catctgttatgcaggatgctggtgtttgatccatctaagaggatttctgccaaggacgct
ttggctcacccttacctagacgagggtcgactgcgctaccacacgtgtatgtgcaaatgc
tgctacaccacatcctccggccgggtttacaccagtgactttgaaccggtcacaaactcc
aagtttgacgatggttttgagaaaaacctgacctctgtgaggcaggtcaaagagatcatc
catcagttcattttggaacaacagaaggggagtcgggtggcgctctgcattaaccctcaa
tcagctgctttcaaaagcttcataagctccacagtagctcaaccctctgaaatgcctccg
tctccgcttgtgtgggaatag

DBGET integrated database retrieval system