KEGG   Xiphophorus maculatus (southern platyfish): 102231958Help
Entry
102231958         CDS       T02923                                 

Gene name
nop58
Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:xma00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    102231958 (nop58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xma03009]
    102231958 (nop58)
Ribosome biogenesis [BR:xma03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    102231958 (nop58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 102231958
NCBI-ProteinID: XP_005808115
Ensembl: ENSXMAG00000013666
UniProt: M4AGW3
Position
24
AA seq 535 aa AA seqDB search
MLVLFETAAGYAIFKVLDESKLQEVDSLYKEFETPEKANKILKLKHFEKFQDTTEALAAA
TALVEGKLGKSLKKALKKVVAKEAHEQLAISDAKLGGVIKEKLDLSCVHSPAVAELMRCI
RSQMEALISGLPPREISAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY
NMRCREWYGWHFPELGKVVTDNLAYCKTVRKVGDRTNVATTDLSEFLPEEIEAEVKLAAE
ISMGTEVSEQDIGNIRHLCDQVIEISEYRAQLYDYLKNRMMAIAPNLTVMVGELVGARLI
SHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGLIYHASLVGQTTAKNKGKIS
RMLAAKTALAIRYDALGEDTNAEMGAENRAKLEARLRQLEDRGIRRISGTGKAMAKADKY
QHKSEVKIYDPSGDSTIPSTSKKRKFEEVETSEQDPVTPVAKSKKPKKESVAEEQEAEMA
AESPKKKKKKKEKKAEEEPEEPEEPKDEEEEMPVSEPTEKKKRKKKKKVKEEEDE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttagtgctattcgagaccgctgctggctacgccatctttaaagtcctcgatgaatcc
aagctgcaggaggtggacagtctgtacaaggagtttgaaactcctgagaaagccaacaaa
atactgaaactgaagcactttgagaagttccaagacacaacagaggccttagcagctgcc
accgcccttgttgagggaaaactcggcaagagtctgaagaaggctctgaagaaagttgtt
gccaaggaagctcatgaacagctcgccataagcgatgcgaaactgggtggagtcattaaa
gaaaagctggacctgagctgcgtccacagccccgccgtggccgagctcatgaggtgcatc
cgcagccagatggaggccctcatctccggacttcctcccagggagatcagcgccatgtcg
ctgggcctggctcacagtttgtcccgctacaagctcaagttcagcccggacaaagtggac
acaatgattgtgcaggccatctctcttctggatgacctggacaaggagctgaacaactac
aacatgcgctgcagggagtggtacggctggcacttccctgagctggggaaggtcgtcaca
gacaatctggcctactgcaaaaccgtccgcaaagtcggtgaccgcaccaacgtggccacc
actgatctgtcggagttcctcccggaggagatcgaagccgaggtcaagctagccgcggag
atctccatgggaacagaagtgtcggagcaggacatcggcaacatccggcacctgtgcgat
caggtcatcgagatctcagagtaccgcgctcagctctatgactacctgaagaacagaatg
atggctatcgccccgaatctgactgtcatggtgggcgagctggtcggcgcgcgcctcatc
tctcacgctggttcccttctgaacctggcgaagcacccggcctccacagtgcagatcctc
ggagccgagaaggctctgttcagagcgctgaagacccgcaaagacactcccaagtacggg
ctcatctatcacgcctctttggtgggtcagactacggctaagaacaaaggaaagatttcc
cgaatgctggcggctaaaacggcgctggctatccgatacgacgcccttggcgaggacacg
aacgcagagatgggagcagagaaccgggccaagctggaggccagactacggcagctggag
gacagaggaatccgaagaatcagcggaacaggcaaagcaatggcgaaggcagacaaatac
cagcacaagagcgaggtgaaaatctacgatccgtccggcgactcgacgattccgtccacc
tcaaaaaagaggaagttcgaggaggtcgagacgagtgaacaggaccctgtgactccggtg
gctaagtccaaaaagcccaaaaaggaatcggtagcagaagagcaagaggccgaaatggca
gcagagtctcctaagaaaaagaagaagaagaaggaaaagaaggcagaggaggaacctgag
gaacctgaggaaccaaaggacgaagaggaggaaatgccagtcagtgagccaacagaaaag
aagaaaaggaagaaaaaaaagaaggtgaaggaggaagaggatgagtga

DBGET integrated database retrieval system