KEGG   Xiphophorus maculatus (southern platyfish): 102232990Help
Entry
102232990         CDS       T02923                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00010  Glycolysis / Gluconeogenesis
xma00562  Inositol phosphate metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102232990
   00562 Inositol phosphate metabolism
    102232990
Enzymes [BR:xma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102232990
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102232990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 102232990
NCBI-ProteinID: XP_005804973
Ensembl: ENSXMAG00000012975
Position
22
AA seq 457 aa AA seqDB search
MMFCLFYCFMIFCCVHHHMTLKDEESIPPIAIYFNTKGRYEEVNPYLRQDILAVNRSSLQ
PPSSQCREIYLTAIIRHGTRYPTAKTVRDMQQLHNIVLNNFPEEQSWLHEILTQWTMWYN
EDMDGRLVQKGVEDLKHLAVRLSKLFPAIISEEKLRGGLFKFITSSKHRCVNSTLSFKAG
LTEMWAITDVEFGHEVNDALMRFFDHCTRFVQEVDQNSSAVIEVDKFKQGLEMMRVQKKI
AEHLGISSSLITYDLAEAAFLLCTYELAVKAVKSPWCLLVDEDDAKVMEYASDLKEFWKR
GYGHDINSKSSCLLFHDLFSRLEKAVSENTLHQQVSEAVTVQVGHADTLLPLLTLLGFFK
DAVPLTSTNYASQTQRSFRTSRMLPYAANFLLVLYDCGEEGIRLQPLLNEKPLTFPGLTD
QQAFMPLYEDVRKHYRDLLSGCDFEAECQLLTNPAEV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttgtcttttttactgctttatgatattttgctgtgttcatcatcacatgaca
cttaaggatgaagaaagcatacctcctattgccatctatttcaacaccaaagggaggtat
gaagaagtgaacccatatctcaggcaggacattctcgctgtaaacagatcttctttacag
cctccatcctcgcagtgtcgggaaatctatcttacggccatcataagacacgggacgaga
tatccaacggccaaaactgtcagggacatgcagcagctgcacaacatcgtcctgaataat
ttcccagaggagcagagctggctgcatgaaatcctgacccagtggacgatgtggtacaat
gaggacatggatggccgactggtccagaaaggtgtggaggatctgaagcatctggccgtc
aggctgtcaaagctcttcccggcaatcatctctgaggagaaacttcgaggtggactcttc
aagttcataaccagctccaagcaccgatgtgtgaacagcacgctgtccttcaaagcaggg
ctgacggagatgtgggccatcacagatgtggagtttggccatgaagtaaatgatgctctc
atgaggttctttgaccattgtaccaggtttgtgcaggaagttgatcaaaactcgtcagct
gtgatagaggtggacaagttcaagcagggactggagatgatgagggtccagaagaaaatt
gcagagcatctgggaatctcatccagtttaatcacatatgatttggccgaggcagcattt
ctcttgtgcacttatgaacttgctgtcaaggctgtaaagtccccctggtgtctactggtt
gatgaggatgatgcaaaggttatggagtatgcaagtgacctgaaggagttctggaaaaga
ggctacggtcatgacatcaacagcaagtcaagctgcctcctctttcatgacctgttcagt
cgactggagaaggcagtcagcgagaacacgttacatcagcaggtcagtgaagcggtgact
gtccaggtcggccatgcagacaccctgctgccattgctcaccctgctcggctttttcaag
gacgcagtcccgctgacatcgaccaactacgcctcgcagactcaacgctctttccgcacc
agccgcatgttgccttacgctgccaatttcctcctcgtgttgtacgactgtggagaggaa
ggcatcaggctgcaacctctgctgaacgagaagcctttgaccttccctggtctgactgat
cagcaggccttcatgccgctctatgaagatgtccgaaagcactacagagatcttctcagt
gggtgtgactttgaggccgaatgccaactactcacaaatcctgctgaagtttag

DBGET integrated database retrieval system