KEGG   Xiphophorus maculatus (southern platyfish): 102234300Help
Entry
102234300         CDS       T02923                                 

Definition
(RefSeq) histamine N-methyltransferase-like
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00340  Histidine metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102234300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xma04147]
    102234300
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     102234300
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102234300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_16 Methyltransf_31 Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 102234300
NCBI-ProteinID: XP_014328394
Ensembl: ENSXMAG00000011623
UniProt: M4AAZ6
Position
7
AA seq 277 aa AA seqDB search
MSAETHTCYEGCNVNIFQFYLEKSGEHAAIVKGLQNVLPAEFQRIGAGKSSLDVLGVGSG
GGEVDIQILSLLQSAFPSVPITADIVEGSSELTANFKALAAKTADLKKIQFSWHIMSSED
YEKAKGGIKKFDFIHMIQMIYYVKSLAESIKFHHELLKNNGRLMIIVEAANSGWDILWKT
YKKELCVGSITEYRSSGEIIFCLKDQSLTFEEHPVPNSFDITECFDRSSVTGERLLSFMT
GTEHFYESFSPEVRAGILDILRNKCSTEKDGRSSTAT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagaaacacacacttgttatgaaggctgcaatgtcaacatctttcagttctac
ctggaaaagtccggcgagcacgcagccatcgtcaagggtctgcaaaatgtcctgcctgca
gaatttcaaagaattggagctggtaaaagcagtctggatgttcttggtgttgggagtggg
ggaggtgaggtggatattcagatactctcacttctgcagtcggccttcccttctgttccc
ataaccgctgacattgtggagggcagctctgagctcacagccaacttcaaagctttggca
gccaagactgctgaccttaagaagatccagttctcttggcacatcatgtccagtgaggac
tacgagaaagcaaagggaggcataaagaaatttgacttcatacacatgatccagatgatc
tactatgtaaagagcctggctgaaagtatcaagtttcaccatgagctcctcaaaaacaat
ggcaggctcatgatcattgttgaagcagccaacagtggttgggacatcctgtggaagact
tacaagaaggagctgtgtgttggaagcatcaccgagtaccgttcatctggagagatcatt
ttctgcctcaaggaccaaagccttacattcgaggaacatccggttcccaacagctttgac
atcacagaatgctttgaccggagcagcgtaactggagaacgtctgctgagcttcatgaca
ggaacagagcacttctatgagtccttcagcccagaggtcagagcaggcatcctggacatc
ctcagaaacaagtgcagcactgaaaaagacggcaggtcttcaacagcaacctaa

DBGET integrated database retrieval system