KEGG   Xiphophorus maculatus (southern platyfish): 102237138Help
Entry
102237138         CDS       T02923                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00561  Glycerolipid metabolism
xma01100  Metabolic pathways
Module
xma_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102237138 (mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xma01002]
    102237138 (mgll)
Enzymes [BR:xma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102237138 (mgll)
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S33
   102237138 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Abhydrolase_2 Lipase_3 Peptidase_S9 LIDHydrolase PGAP1 DLH Thioesterase Abhydrolase_5 Abhydrolase_3 FSH1 DUF1057
Motif
Other DBs
NCBI-GeneID: 102237138
NCBI-ProteinID: XP_005814709
Ensembl: ENSXMAG00000009052
Position
1
AA seq 345 aa AA seqDB search
MNAVTTAACLLVAAFSCYLYGGGDVLSSLLGVFSADGPSMPEPGDAPRRSPQGVPYTELR
HIVNADGLHLFCRYWEPASPPRALVFIAHGAGEHSGPYEEIAQRLKERSLLVFAHDHVGH
GQSEGERMNIRDFQIYIRDSLQHIDLMKSRHPDLPVFIVGHSMGGAISILTACERPNDFT
GLVLISPMVQMNPESATPFKVFVAKLLNHMLPSLSLGSIESKWISRDKTQVEAYDNDELN
YHGRLRVSFGIQLMAAAERIERAIPSISWPFLLLHGDADKLCDIRGSKMMYEKAASSDKK
LTIFEGGYHALHHDLPEVAETVLKDVTSWITDRLPPASTPPQQGS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtgaccaccgccgcctgcctgctcgtcgctgccttcagctgctacctctac
ggcggcggcgacgtgctgtcatcgctgctcggtgtcttttctgcagacggaccctccatg
ccggagccgggagatgctccgcggcgaagcccgcagggagtcccctacaccgagctgcga
cacatcgtcaacgccgacggactgcacctgttctgccgctactgggagcccgcaagtccg
ccaagggctctggtgtttattgctcatggagcaggagagcacagtgggccatatgaagaa
attgcacagagactgaaagagcggtccctgctggtgtttgctcatgaccacgttggccat
ggtcagagtgaaggagagaggatgaacatcagggactttcagatttacatcagggattcc
ctgcagcacattgacctcatgaagtcccggcatccggatcttcccgtctttattgtgggc
cactccatgggtggcgctatctccatcctcactgcctgtgaaagacccaatgatttcact
ggactggttctcataagcccgatggtccagatgaacccagagtctgcaacaccctttaag
gttttcgtggcgaagctcctgaaccacatgctgccgagcctctctctgggatccatcgag
tccaaatggatctcacgggacaaaacgcaggttgaggcatatgacaatgatgagctgaac
taccatggcaggttacgggtgtcgtttggcatccagctgatggcggcggccgagaggatc
gagagggcgatcccatccatcagctggcccttcctgctcctccacggcgacgctgacaag
ctctgtgacatccgaggctctaagatgatgtatgagaaagctgcaagttcggataaaaaa
ctaacgatctttgaaggaggataccacgctctccatcatgacctccctgaagtggccgag
actgtgctgaaggacgtgacgagctggatcacagaccgactccctccagcatcgacgcca
ccgcagcaaggctcgtag

DBGET integrated database retrieval system