KEGG   Xiphophorus maculatus (southern platyfish): 102237237Help
Entry
102237237         CDS       T02923                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04012  ErbB signaling pathway
xma04068  FoxO signaling pathway
xma04137  Mitophagy - animal
xma04140  Autophagy - animal
xma04141  Protein processing in endoplasmic reticulum
xma04210  Apoptosis
xma04217  Necroptosis
xma04310  Wnt signaling pathway
xma04510  Focal adhesion
xma04530  Tight junction
xma04620  Toll-like receptor signaling pathway
xma04621  NOD-like receptor signaling pathway
xma04622  RIG-I-like receptor signaling pathway
xma04625  C-type lectin receptor signaling pathway
xma04910  Insulin signaling pathway
xma04912  GnRH signaling pathway
xma04914  Progesterone-mediated oocyte maturation
xma04920  Adipocytokine signaling pathway
xma04933  AGE-RAGE signaling pathway in diabetic complications
xma05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102237237
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102237237
   04012 ErbB signaling pathway
    102237237
   04310 Wnt signaling pathway
    102237237
   04068 FoxO signaling pathway
    102237237
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102237237
   04137 Mitophagy - animal
    102237237
  09143 Cell growth and death
   04210 Apoptosis
    102237237
   04217 Necroptosis
    102237237
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102237237
   04530 Tight junction
    102237237
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102237237
   04621 NOD-like receptor signaling pathway
    102237237
   04622 RIG-I-like receptor signaling pathway
    102237237
   04625 C-type lectin receptor signaling pathway
    102237237
  09152 Endocrine system
   04910 Insulin signaling pathway
    102237237
   04920 Adipocytokine signaling pathway
    102237237
   04912 GnRH signaling pathway
    102237237
   04914 Progesterone-mediated oocyte maturation
    102237237
  09158 Development and regeneration
   04361 Axon regeneration
    102237237
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102237237
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102237237
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102237237
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102237237
Protein kinases [BR:xma01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102237237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102237237
NCBI-ProteinID: XP_005795371
Ensembl: ENSXMAG00000008807
UniProt: A0A3B5Q2V8
Position
23
AA seq 420 aa AA seqDB search
MSEAEGQFYSVQVGDSTFTVLKRYQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLCRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLINVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEILG
TPSLEFMNRLMETVRNYVMNKPQYPGVSFTELFPDWAFPSESEQDKVKTVQARDLLSKML
VIDPECRISVEEALHHPYIHVWYDPAEADAPPPQISDKQLEEREHTIEQWKELIYEEVID
WEERNKNGLMKEDCSDVASGSASQSSSANDISSMSTEHTLASDTDSSSIDTLTGPLDESQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggcggagggccagttctacagtgtccaggtgggggactccaccttcactgtg
ctcaagcgctaccagcagcttcgtgccattggctcaggggcccaaggcattgtctgctct
gctctggatacagtcctcggtataccagtggctgtgaagaagctgtgtcggccctttcag
aatcagacccatgcaaagcgggcctacagggaactggtgctgctgaaatgtgtcaaccac
aaaaatatcatccgtctgatcaatgttttcacgcctcagaagtctctggaggagttccag
gatctttacctggtgatggagctgatggatgccagcttatgtcaggtgattcacatggac
ctggaccacgagaggatgtcctacctgctctatcagatcctttgtggcatcaggcacctg
cactcagctgggatcatccacagagatctgaagcccagcaacattgttgtgaagtctgat
tgcactctgaaaatccttgacttcggtcttgcacggacagcttgcacaaacttcatgatg
accccctatgtagtaacccgatactaccgcgccccagaggtcattctgggcatgaagtat
aaggagaatgtggacatctggtcagtggggtgcatcatgggagagatggtaaaaggcagc
gtcatcttccagggcaccgatcacatcgaccagtggaataaagtgattgagattctgggt
acgcccagtctcgagtttatgaaccgactgatggagaccgtaaggaactatgtgatgaac
aagccgcagtatccaggcgtcagcttcacagagctgttcccggattgggctttcccttct
gaatctgaacaagacaaagtgaaaactgttcaagctcgggatctgctctccaaaatgctg
gtcattgatccggaatgccgtatctcggtagaggaagcccttcatcacccctacatccac
gtgtggtacgaccctgcagaggcggacgcgcctcctcctcagatttcagataagcagctg
gaagagagagagcacaccatcgagcagtggaaagaacttatttatgaagaagtgatagac
tgggaggagaggaacaagaatggtctaatgaaagaagactgctcagatgtggcgtccggt
tccgcttcccagtcgtcctcggccaacgacatttcgtccatgtccacagagcacacgctg
gcgtcggacacagacagcagcagcatcgacacgctgacagggccgctcgacgagagtcag
tga

DBGET integrated database retrieval system