KEGG   Xiphophorus maculatus (southern platyfish): 102237546
Entry
102237546         CDS       T02923                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xma01002]
    102237546 (adamts13)
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102237546 (adamts13)
Peptidases and inhibitors [BR:xma01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102237546 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN TSP1_spondin Reprolysin_4 Reprolysin_3 Reprolysin_5 Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 102237546
NCBI-ProteinID: XP_014327209
Ensembl: ENSXMAG00000000162
Position
12
AA seq 1408 aa
MSRREHIYIYSLSVTAEQVDTQKKGGEKMFILTAVCLLLLLPGFSALMGSPQDEPQEKVS
ALDSSADTTVSDRLRRSTLIPDITHLELLVVVGPDVQQVHKQDTERYILTNLNIASELLR
DMTLGANMRVHLVRMIILSEPEPEIQMSTNITSSLRSVCDWGRRINPSNDSDPLHADLLL
YITRYDLELPNGNKQVRGVTQLGGVCSSNWSCVITEDTGFDLGITIAHEVGHSFGIDHDG
SANGCSRSGFMMASDGGYNSVDLTWSPCSRHQLLTFFSEGRAECVKDFPALGGSLQDWKP
GLYYGVDDQCRIAFGSTARACSFSNPDLPACRTLSCHVEPQDISSCKRLLVPLLDGTECA
PNQWCLKGRCVSPDDFGVSVVVNGSWSSWSGFSSCSRTCGGGVMLRTRECNNPRPAFGGN
DCDGPDIEAELCNQLPCEQTQLDFVAEQCSQTDPQPLYLLPNTASFYKWIPAIDFVKGDE
QCRYMCQSDGERFIVSRGSYFADGTRCKSDISTPYGATAACLQGRCQVFGCDGVLHSGKA
WDVCGVCGGDGSTCILTSDSYSGGGAKDYNTFLTLPVNATQVHIVNRAPVFTHLAMMVGD
QYIVSGSGTMALNTTHPSPLDDDYVQYRLHLTPDLLPEMEEVVVPGPLKQEMTIQVYRKY
GKEYGEKTNPNISFQFYVPRNKSLTDSSPRGKWAPLATPCSVTCGLGIQKNEHVCIDEDT
NKLLKPHYCKAPPPPTALHTTCQLPSCPPRWDAGNFGVCSASCGGGFRVRHVRCVQKHES
DVVKVPDSECSADTAPHPLEKCNLHHCPARWSVSEPGNCSAVCGPGEAERNVSCIRQEDG
LDVEVDHSFCLNQIKPPYSVPCVVDVCPIGWDSKVEERPSLKSGLLPRSRQAPVYVWSPV
VSQCSRSCGNGNLQVWFSCVDHQTRLGVPDFHCDSSSKPDPHTEMCGFSPCPPKWRSKQG
VCSVTCGGGVAKRVLYCARETDGEEEEVLEDYNCRGFPKPTAVVSCNTHSCPARWKVFRT
SPCSVSCDLGVAQRNVSCVQFVHGKESVVPEDGCRAAVKPATTVPCLVQVCTYKWEVKPW
SQCSSSCGYGIQSRAVSCMGPPKPEPLSPLFCMHMPKPITIRGCDTGSCRDVALNKTTQT
LKANSTEKALPSPPPVHKDASRRRMGSLPPRPTETMAIKETTTATPTPKPNACGLLLLEE
SGTVDLHNAPSRCTVSVGRPLDEVISITLISSSLDCRKREYVAFFDRLAIVRKCVQAAGS
ELTTRTNVLLVRQSLVTPGNGVVFTYRSKKNTKRSHHQDCDIQLFSPSGIFENPVTSNTS
RTCRVLINAPPSVKIRVQALHIALPFNTTSAQSTYIMIRDMDVLKTNVFNGQQLFLWHSS
GNMAEVEFHGDYLYSQGTFRAEYSFVRL
NT seq 4227 nt   +upstreamnt  +downstreamnt
atgagcaggagggaacatatatatatatatagtcttagcgtcacagcagagcaggtagac
acgcagaaaaaaggaggggaaaaaatgtttattctgactgcggtctgtcttctgctccta
ctgcctggcttcagcgctctaatgggatctcctcaggatgagccacaggaaaaagtctcc
gctctagattcctctgcagacactacagtaagcgaccgtttgcgtcgctccactctgatt
cctgacatcacgcatctggagctgctggtggtagtggggccagacgtccagcaggtccac
aagcaggacacggaacgatacatccttaccaacctcaatattgcctctgagctgttgaga
gacatgaccctgggtgccaacatgagggttcacctggttcgcatgatcatcctatcggag
ccagagccagagatccaaatgtccaccaacatcacctcgtctctgagaagtgtgtgtgac
tggggcagaaggatcaacccctcaaatgactcagacccgctacacgctgacctcctgcta
tatataacgaggtatgacttggagctgcccaatgggaacaagcaggtcaggggggtgaca
cagctgggaggggtctgctccagcaactggagctgtgtgatcacagaggacacgggcttc
gacctgggcatcaccatcgctcatgaagtcggccacagcttcggaatcgaccatgatgga
tcggcgaacggctgcagtcggagcggcttcatgatggcctcggatggaggctacaacagc
gtggatctgacctggtccccctgcagtagacatcagcttctcaccttcttcagtgaaggc
agagctgaatgtgtgaaggatttccccgcactgggaggctccctgcaggactggaagccc
gggctgtattacggagttgacgaccagtgtcgcatagcctttggcagcactgccagagcc
tgctctttctccaatcctgacctgccggcttgccgtactctgtcttgtcatgttgaaccc
caagacatcagctcctgtaaacgcctcctggttccactgctggatggaacagagtgcgca
cccaatcagtggtgtctgaagggacgctgtgtgtccccagatgacttcggcgtctctgtc
gtagtcaacggctcctggtccagctggtctgggttttcctcctgctccaggacgtgtggc
ggaggggtcatgctacgtacgagggaatgcaacaacccaagacctgcttttggagggaat
gactgtgacggcccagatattgaggctgaactttgtaaccaactgccttgtgagcagacc
cagttggacttcgtggcagagcagtgttcccaaacagacccccagcccttatacttgctt
cccaacactgcctcgttctacaaatggatccccgctatcgactttgtcaaaggagatgag
cagtgcagatacatgtgtcagtcagatggagagcgcttcatagtgagccgtgggtcttat
tttgcggatgggactcgctgcaagtcagacatctcaactccttacggcgcaacagctgct
tgtcttcaagggagatgccaggtattcggctgcgatggcgtgctgcactctgggaaggcg
tgggatgtgtgcggggtgtgtggtggagatggatccacctgcattttgacatccgactcg
tacagtggtggtggtgccaaagactacaacacttttctcactctgccggtgaatgccact
caggtccatattgttaacagggcacctgtcttcactcatttagctatgatggttggggat
cagtacattgtgtccggatcgggtaccatggctctgaataccacccatccctcaccgcta
gatgatgactatgtacagtaccgccttcacctgactcctgaccttttacctgagatggaa
gaggtggtagtacctggacctctgaaacaggagatgaccatacaggtctatcgcaaatat
ggaaaggaatatggggaaaaaacaaatccaaacattagctttcagttttatgtgccaaga
aacaagtctttgacagacagctcacctagaggcaaatgggctccgttagcaacaccctgc
tctgtcacttgtggattgggtatacagaagaatgagcatgtctgcatagatgaagacacc
aacaagcttttgaagccacactactgtaaagcccctcctccacccacagcactacacaca
acctgtcagcttccatcctgtccccccaggtgggatgcaggaaattttggggtctgcagt
gcctcctgtggcggcggatttcgggtgcgtcacgtgcgatgtgttcaaaagcatgaatcc
gacgtggtaaaggttcccgattcagagtgctccgcagataccgctccccaccctttggaa
aaatgtaacctgcaccactgccctgccagatggtctgtctcagagccggggaactgctct
gctgtgtgtggaccgggggaagcagaacgcaacgtgtcttgcatccggcaagaagatggc
ttagatgtcgaggtggaccatagcttttgtttaaatcagatcaaacctccatattcggtg
ccatgtgtggtggatgtctgccctatcgggtgggactctaaggtggaggagcggcccagt
ttaaagtctggcttgcttccacgctccagacaggctcctgtgtatgtctggagccccgta
gtcagccagtgttctaggagctgtgggaatggaaacctacaggtttggttttcttgtgtg
gatcaccagaccagactgggggtccctgacttccactgtgactcctccagcaaaccagat
ccgcacactgagatgtgtggtttttctccctgccctccaaagtggcgctctaagcaagga
gtctgcagcgtaacgtgtggaggaggggtagccaagagagtgctgtactgtgctagagag
acagatggagaggaggaggaggtgttggaggattacaactgcagaggctttcccaaacca
acagcagtggtttcatgtaatactcacagctgccctgcaaggtggaaggtatttaggaca
tcgccctgctctgtgtcctgcgacctgggtgtagctcagaggaatgtgtcctgtgtccag
tttgttcacgggaaggagagcgtggtgccagaggacggctgccgtgcagctgtcaaacct
gccaccactgtgccttgcctggtgcaagtgtgcacctacaagtgggaggtgaaaccatgg
agccagtgttcatcatcctgtggatacggtatccagtcccgagctgtgtcctgtatgggc
ccccctaagcctgagcccctcagccctctgttttgcatgcacatgcccaaaccgatcaca
atcagaggctgcgacacgggcagctgcagagacgtggccttgaacaagaccactcaaacc
ctgaaagcaaactccacagaaaaggctcttccatctcctcctccggttcataaagatgcg
tcacggcgccgcatgggcagccttcctccgaggccaacagagaccatggccatcaaagag
accaccacagccactccaacgcctaagcctaatgcatgtggacttctactgctggaggaa
tcaggcaccgtggatttacacaatgcgccgagcaggtgcacagtgtcagtaggtcgaccc
ctcgacgaggtcatcagcatcacactcatatccagctctttggattgcagaaaaagggaa
tacgtggcgtttttcgatcgtctggctatcgtgaggaagtgtgtacaggcagcaggcagt
gaactgaccaccagaaccaatgtcctgcttgtccggcaaagtctggtcactcctggaaat
ggggttgtgtttacctacagatcgaagaagaacacgaaaaggagtcaccatcaggattgc
gacattcagctcttttcccccagcggcatttttgagaatccagttacgtccaacaccagc
cgcacctgccgagtgctcatcaacgcccctccctcggtgaagatcagggtccaggcgctc
cacatagcattaccattcaacaccaccagtgcccagtccacatatatcatgatccgagac
atggatgtcttaaagaccaacgtgtttaacggccagcagctgttcctgtggcactcctct
ggaaatatggctgaggttgaatttcatggcgactacctgtattcccaaggaaccttcaga
gctgaatactcctttgtgcgactttga

DBGET integrated database retrieval system