KEGG   Xiphophorus maculatus (southern platyfish): 102238353Help
Entry
102238353         CDS       T02923                                 

Definition
(RefSeq) retinal guanylyl cyclase 2-like isoform X1
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00230  Purine metabolism
xma01100  Metabolic pathways
xma04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102238353
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    102238353
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102238353
Enzymes [BR:xma01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102238353
Protein kinases [BR:xma01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   102238353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Curto_V3 YCF90
Motif
Other DBs
NCBI-GeneID: 102238353
NCBI-ProteinID: XP_023202122
Ensembl: ENSXMAG00000013383
Position
2
AA seq 1062 aa AA seqDB search
MQLVSLLGLFLWLFYISDVGAATFKLALVGPWSCDPLFSRAMPVAAANLALSRLRSDSYM
SRGYWYDVKLLNEDCSVSKALAELGEMEGYGHAYIGPFNPTLCHAASLFTQHWEAGLSSP
GCLDDDWLNLPPVTPPIKVLKTVLRFFRWAHVAVISAPTDLWDSTGEEVASALRAVGLPI
APVVSMETNKGGAREALNEIRQSDKVKVIIMCMSSILIGGEHQRELLLEALEMGMIADGY
VFIPYDTLLYAMPYQDTTFPLLTNNTKLQHAYSAVLTVTMASDESFYETFRQAQISREIR
SAISATEVSPLFGTIFNMVYFVAKAVEERRQAGGGHWVTGNQLFSSDGGFDFQGFNQVLY
GGRGGSGLRAKYVVLDSDGDHLVPTHSLGPTHIDGTVGGLRPLSRSFYFPGGKPPKASFC
WFSPEETCNGGVDAVTMFFLFLLLCGLTSAAFFWLRKYRRTPNVTKLILTLDDIVFIDTQ
VSKKKLNDESIMRSLLEIKTPLRSIARSYILTSPESSNIGILEGDWVWLKKIPVGKTATP
VNQSTQNLFSQLREMRHENLNLYLGLFVDSGILALVVEHCPRGSLADLLADSDVRLDWMF
KSSLLMDLIKAAVFMFQGMKYLHLRGLTHGRLKSTNCLVDGRFVLKITDYGLPMILQSQG
VSLSDDPQDLLWTAPELLRNSEQAGSFAGDVFSFSIIIQEVISRTLPYAMMDMPAQEIVE
RLKKPPPLCRPLVSVDEAPAECLNLMNECWNEDPSKRPNFDEIFKQFRGISRGKKANIID
SMLRMLEQYSSNLEDLIRERTDELEVERTKTDKLIGQLLPKSVAQALKKGKPVQPEHYSD
CTLYFSDIVGFTTISALSEPIEVVDLLNDLYTMFDAIIATHDVYKVETIGDAYMVASGVP
NRNGNRHAAEVSNMSLDILHSIGAFKIKHMPEIKVKIRIGLHSGPVVAGVVGLTMPRYCL
FGDTVTTASHMEASGLPYRIHISLSTVKVLTSLKVGYLIDTRKAQVKGTEDTYWLMGREG
FNKPLPLPPDLAGGASNHGISLDEIPVERRQKFLDRQNKMKK
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgtctccttgcttggactgtttctctggttgttttatatcagcgatgtgggg
gcagcgacttttaaactggccctggttggcccttggtcctgtgaccctctgttctccaga
gcaatgccagtagctgcggctaacctagcattatcacggctaagaagtgacagctacatg
agcagaggatactggtacgatgtgaagctgctcaacgaggactgctctgtgtccaaagcg
ttggctgagttgggggaaatggagggttatggtcacgcttacatcggacctttcaacccg
accctctgccacgcagcgtccttgttcacccagcactgggaggcagggctttcttctcca
ggttgtctggatgatgactggctgaacctgccccccgtaacgcctcctattaaggtcctc
aaaactgtcctaagattcttccgctgggctcacgttgcagtcatttcagccccaactgat
ctctgggacagcactggagaagaagtagcctctgcactccgggctgtgggcttgccaatt
gctcctgtggtttctatggaaacaaacaaaggcggggctcgggaggcgctgaacgaaatc
aggcagtccgacaaagtcaaagtgatcatcatgtgtatgagttccatcctgattggtgga
gagcaccagagggaactcctgctggaggctctagaaatggggatgatcgctgatggttac
gtcttcattccatacgacaccttgctgtacgccatgccttaccaggacacaacattccct
ctgctgaccaacaacaccaagctgcagcatgcctacagcgccgtgctgaccgttaccatg
gcttctgatgagagtttctatgagacctttcgccaggctcagatctccagagagatccgc
tccgctatctctgccacagaggtgtctccactgtttgggaccatctttaatatggtctac
tttgttgctaaagccgtggaagagcgtcgccaggcgggtggtggacactgggtgacagga
aatcagctcttcagctcagatggagggtttgatttccagggcttcaaccaggtgttatac
ggtggtagaggcgggtctggtcttcgggccaagtatgtggtgctggacagcgatggcgac
caccttgtgccgacacattcacttggaccgacacacatcgacggaacggtcggtggtctg
agacctctgagccggtccttctacttcccaggaggaaaacctcccaaagccagtttttgt
tggttcagtccagaggaaacttgcaacggaggtgtggatgcagtgacaatgttcttcctc
ttcctgctgctttgtggtctcacttcagctgctttcttttggttgaggaagtacaggaga
acaccaaacgtcaccaaattaatcctgaccctggacgacattgtgtttattgacactcaa
gttagtaagaagaaattaaatgatgaatccatcatgaggagtcttttggaaataaaaact
cccctccgctcgatagccagaagttacatcctgacgtcaccggagagttctaacattggg
atattggagggagactgggtttggctgaagaagattcctgttggaaagacagcaacacct
gtcaaccagagtacccagaatctgttcagtcagctgcgggagatgcgccatgagaacctg
aatctgtacctgggtttgtttgtggattcagggatcctagccctggtggtggagcactgt
ccccgcggcagcctggcagacctgctggctgacagcgacgtcaggctggactggatgttc
aagtcatcgctgctcatggacctcattaaggctgctgtcttcatgttccagggaatgaag
tatcttcatctgcgagggttgactcacggtcgcctcaagtccacaaattgcttagtggac
ggccgatttgtgttgaaaatcacagactacggtctacccatgatccttcagtctcaaggt
gtcagtctgtctgacgatccacaagatcttctgtggacagctcctgaacttctgaggaat
tcagaacaagccggttcttttgccggagatgtctttagtttttccatcatcatacaggaa
gtgatctcacggacacttccctacgccatgatggacatgcctgctcaggagattgtggag
cgtctgaagaagccccctcctctttgtaggcctcttgtttcagtggatgaagctcctgct
gagtgtctcaatctgatgaatgaatgttggaacgaagatccgagcaagcgacccaacttt
gacgaaatttttaagcagttccggggcatcagcagagggaagaaggctaatatcattgac
tccatgctgcggatgctggagcagtacagctccaacctggaggatctgatcagggagcga
acagatgagctggaggttgagaggaccaaaacggataagttaattggacagcttttacca
aaatctgtggctcaggccttgaagaaggggaagcctgtccagcctgaacactactcagac
tgcacactttacttcagcgacatcgtcggatttacaaccatctcagctctaagtgaaccc
attgaggtggtcgacttgcttaatgacctttacaccatgtttgatgccatcattgctact
catgatgtctacaaagtggagactattggggacgcttacatggtggcttcaggtgttcct
aatagaaatgggaatcggcacgcagctgaagtgtcaaacatgtcgcttgacatccttcat
tcaataggagcatttaagatcaaacatatgcctgaaatcaaagtgaaaatacgcattgga
ctgcactccggaccagtggttgcaggtgtggtgggactgaccatgcccaggtactgtctg
tttggagacacggtgaccacagcctcccacatggaggccagcggcctgccttacaggatc
cacatcagccttagtactgtcaaggttctgaccagtctgaaagtgggatatctcatcgac
accagaaaggcacaggtaaaggggacagaggacacatactggctgatgggtcgagagggt
ttcaacaaacctcttcctcttccccctgatcttgctggaggggccagtaatcacggcata
agcctcgatgagattcctgttgagagacggcaaaagtttctcgaccgacagaacaaaatg
aaaaaatag

DBGET integrated database retrieval system