KEGG   Xiphophorus maculatus (southern platyfish): 102238404Help
Entry
102238404         CDS       T02923                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xma01002]
    102238404
Enzymes [BR:xma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102238404
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S33
   102238404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 Chlorophyllase
Motif
Other DBs
NCBI-GeneID: 102238404
NCBI-ProteinID: XP_005805741
Ensembl: ENSXMAG00000017177
Position
1
AA seq 350 aa AA seqDB search
MKIFWIFRAAMAAELDVVNLFFIAGATLAIPILAFLASFLLWPSVLIKVYYWYWRRTLGL
QVHYADCGGYRFCYSYRGKPGMRPSILMLHGFSAHKDMWLTVVKYLPKHLHIVCVDMPGH
EGTTRTNTEDYSVQGQVRRIHQFVGSIHLNRKAFHLVGTSMGGNVAGVYAACYPSEICSM
TLICPDGIRHPCETKFDNHLQDLEHSNFTLNIPLIPTTPDEMEDMFKLCSHVRFKIPQQI
LQGLVDVREPHNAFYEEVFMEIIGEKSRYALHEHLHLITSPLQVIWGKQDQVVDVSGATV
IAELVPGCRVDLLDNCGHSVVMEKPCRTAKLILEFIILQQTARSGTKKSS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttctggatttttagggcagccatggcagctgaactggatgtagtgaacctg
ttcttcattgctggagcaacactggctattcccatcctggcttttctggcttccttcctt
ctttggccatctgtactcattaaagtgtattactggtactggagaaggactttgggcctg
caggttcactatgcagactgtggaggttatcgcttctgctattcctacagaggaaaacct
gggatgagaccctccatcctgatgcttcatggcttctctgctcacaaagacatgtggctg
actgttgtcaagtatttaccaaagcacctgcacattgtgtgcgtggacatgcctggccac
gaggggacgacacgcaccaacactgaggattactccgttcaggggcaggtcagaaggatc
catcagtttgtaggaagcattcacttaaacagaaaagcgttccatctggtgggaacctcc
atggggggaaatgttgctggggtttatgcagcctgctatccctcggaaatctgcagcatg
actctcatctgtcccgatggaatcagacatccatgtgagaccaaatttgacaatcacctt
caagatctggaacacagcaacttcacactgaacatcccgctgatcccaactacaccagac
gagatggaggacatgttcaaactctgttctcatgttcgctttaaaattcctcagcagatt
cttcagggactggttgatgtgcgagaacctcacaacgcgttttatgaagaagtttttatg
gagatcatcggtgagaaatcaagatatgccttacacgagcatttgcatctcataacctca
cctttacaagtgatttggggcaaacaagatcaggtggtggatgtctctggagctacagtc
attgctgaattggtgcctggatgcagggtggacttgctggacaactgtggtcactctgtg
gtgatggagaagccgtgtcggacagccaaacttattctggagtttattatcctgcagcaa
actgccaggagcggcacaaagaagtcttcttga

DBGET integrated database retrieval system