KEGG   Xiphophorus maculatus (southern platyfish): 106699639
Entry
106699639         CDS       T02923                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04080  Neuroactive ligand-receptor interaction
xma04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106699639 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106699639 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 106699639
NCBI-ProteinID: XP_014324433
Ensembl: ENSXMAG00000013581
Position
23
AA seq 75 aa
MNVKILTLVIVLLVSLLCPAGAGPMASTEHGRGLEEAATVRKMAQQNPVRGGQTHRPAKR
RRPRPRLSHKGPMPF
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgtcctgcc
ggtgctggtcccatggcctccacggagcatggcagagggctggaagaggcagctacagtg
agaaaaatggcccagcagaacccagtgagaggcggtcagacccacagaccagccaagaga
agacgcccacggccccgtctttcccacaaggggccaatgccgttctag

DBGET integrated database retrieval system