KEGG   Xiphophorus maculatus (southern platyfish): 106699822Help
Entry
106699822         CDS       T02923                                 

Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1-like
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00760  Nicotinate and nicotinamide metabolism
xma01100  Metabolic pathways
xma04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    106699822
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    106699822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:xma04090]
    106699822
   00536 Glycosaminoglycan binding proteins [BR:xma00536]
    106699822
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     106699822
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     106699822
CD molecules [BR:xma04090]
 Proteins
  106699822
Glycosaminoglycan binding proteins [BR:xma00536]
 Hyaluronan
  Cell surface receptors
   106699822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse C1_2
Motif
Other DBs
NCBI-GeneID: 106699822
NCBI-ProteinID: XP_014326758
UniProt: M4A1U5
Position
21
AA seq 261 aa AA seqDB search
MGLKTNLAVAAGLLLLAVVVVVPPATLLSPRTSQFRATFRQKCQAFPETSQRCEQLLSMF
EEAYVGQDPCNFPDEAYHPLFVENPFIHSCDKTMFWSDTKDLVHQFCKGRNHFVSLENSL
LGNIMDGLTWCGKKSSKDTFFYLCEKCDINTVSSFWVRASAEFADYACGNASVLLNGAIS
KPFDPTSYFGAVEVRKLAFPRVQSLTVILVIKNNNADCSHESLQVLRNVLDPNVTLHCRS
VTEAKLLECVEAGTTTDACWT
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggggctcaaaacaaacctggccgtagccgctggtctccttctcttggctgttgtagtt
gtggttccaccagcaactctcctttctcctcgaacgtcccagttcagggcaacattcagg
cagaaatgtcaggctttcccagaaaccagccaaagatgtgaacagttattaagtatgttt
gaggaagcctatgtcggacaagatccatgtaactttccagatgaagcttaccatccgctc
tttgtggagaaccccttcatacattcatgtgacaagacaatgttctggagcgacacaaag
gatctggtgcatcagttctgtaagggaaggaatcatttcgtctccctggagaactcgctg
ttagggaacattatggacggcctgacatggtgtggaaagaagagcagcaaagacacattc
ttctatttgtgcgaaaagtgtgatatcaacaccgtgtcttcattctgggtcagagcctct
gcagagtttgcagactatgcatgtggaaatgccagtgttctgctaaacggagcgataagc
aaaccatttgatcccaccagttactttggagccgtcgaagttaggaaactcgcctttccc
agagtgcagagcctgactgttattcttgttatcaagaataataatgcagattgtagccac
gagtctctgcaggttttacgaaacgttctggatccaaatgttactctccactgccgttcg
gttactgaagccaagctactggagtgtgtagaagcaggtacaaccactgatgcctgttgg
acttaa

DBGET integrated database retrieval system