KEGG   Xiphophorus maculatus (southern platyfish): 106700049Help
Entry
106700049         CDS       T02923                                 

Definition
(RefSeq) L-amino-acid oxidase-like isoform X1
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00250  Alanine, aspartate and glutamate metabolism
xma00270  Cysteine and methionine metabolism
xma00280  Valine, leucine and isoleucine degradation
xma00350  Tyrosine metabolism
xma00360  Phenylalanine metabolism
xma00380  Tryptophan metabolism
xma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xma01100  Metabolic pathways
Module
xma_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106700049
   00270 Cysteine and methionine metabolism
    106700049
   00280 Valine, leucine and isoleucine degradation
    106700049
   00350 Tyrosine metabolism
    106700049
   00360 Phenylalanine metabolism
    106700049
   00380 Tryptophan metabolism
    106700049
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    106700049
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     106700049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox Pyr_redox_2 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C Thi4 FAD_binding_3 MCRA Lycopene_cycl GIDA 3HCDH_N NAD_binding_7 NAD_Gly3P_dh_N Trp_halogenase Pyr_redox_3 FMO-like TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 106700049
NCBI-ProteinID: XP_023207167
Position
18
AA seq 548 aa AA seqDB search
MPRAPTTYHTFPLTEVSVSSLTVTTHSRGRRSKLWSSALQMMPHMVLCKYVPLVLVGVVV
LAASGIIGDPLYECLQDADYRELLDIVTDGLPAARMPQHVAVIGGGMAGLTAAKVLEDAG
HKVTIIEASERIGGRVETFRNRREGWYAEMGAMRIPSFHKILLSFISKLKIPLNSFIQDD
INTYYLVNGGLHKTYTVKNNPSVLNYSLHDREKGKSAAELFSQTLWKVRDDLKTLGCSGM
LKKYDSYTVKEYLVKEGNLSRGALRMIGDILNENSLFYTSLIEMLYIQTDINDNTQYFEV
TDGFDQLPTAFYQVLNATILLNSKVKLIDQTDEANVTVTYEDWRNSGSLSKVTVDYALVT
ATAKATLFIDFYPPLSGNKMEALRSVHYASSTKVVLSFKERFWEKEGIKGGKSITDRPSR
FIYYPSHAFPGTTAGALLASYTCSDDSTLFQGMNEEDLMAVALEDLVKIHGEYIRPLCTG
GLVKKWGLDPYSFGAFALFMPYQQGHYARELFQSEGRVHFAGEHTATPHGWIETAMKSAL
RAAKNINT
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcccagggctccaactacttaccatacgtttcctttgacagaggtttctgtttcctct
ctgaccgtcaccacacacagcagagggaggaggtccaaactgtggagttctgctctccag
atgatgcctcacatggttctgtgcaagtacgttccgctggttctagtgggagttgtggtt
ttggcagccagcggaatcataggagaccctctctatgagtgtctccaggacgctgactac
agagagctcctggacattgtgacggatggactcccagctgccaggatgcctcagcatgtg
gcagtcatcggcgggggcatggctggactgactgctgccaaggtcttagaagatgcagga
cataaggtgaccataatagaagctagtgagcgaatcggaggacgggtggaaaccttcagg
aacagaagagaaggctggtacgcagagatgggagccatgaggatccctagcttccataag
attctactttcctttatctccaaattgaaaatcccactgaattccttcatccaagatgac
atcaacacctactacttggtaaacggaggcctacacaaaacctacaccgtaaaaaacaat
cccagcgtgctcaactacagtttgcatgacagagagaagggaaagtcagctgctgaactc
ttcagtcagacactctggaaggtgagggatgacctaaagacattgggctgcagtggaatg
ttgaagaaatatgactcctacacagtgaaggaatatttggtgaaggagggcaacctgagc
cgcggcgctttgagaatgattggtgacatcctcaatgaaaacagcctcttctacacgtcc
ttgatagagatgctctacatacagaccgacatcaatgacaacacacagtactttgaagtg
acagatggttttgaccaactccccacagctttctatcaagttttaaatgccacaattctg
ctgaactccaaagtgaagcttattgaccaaacagatgaggctaatgtgactgtaacgtat
gaagactggcggaactcaggttccctgtcaaaagtgacagtggactatgcccttgttacg
gccacagccaaggccaccctcttcattgacttctaccctcctctgtctggtaacaagatg
gaggccctgcgctctgttcattatgccagctccacaaaggtagtgctcagtttcaaggaa
cgcttttgggagaaagaaggcatcaaaggagggaaaagcatcaccgaccgaccatctcgc
ttcatctactaccccagccatgcattcccaggtaccactgcaggggccctcctggcttcc
tacacctgctccgatgactccaccctttttcaaggcatgaatgaggaagatctgatggca
gtagctctggaggacttggtgaaaatccatggggagtatatccgaccgctctgcacgggg
ggtctggtgaagaagtggggcctggacccttacagctttggagcctttgccctgtttatg
ccgtaccagcagggacactacgcacgagaactgttccagagtgagggacgggtgcacttc
gccggggaacacacagcaacccctcacggttggatcgaaactgccatgaagtctgctctc
agagcagctaagaatatcaacacttga

DBGET integrated database retrieval system