KEGG   Xiphophorus maculatus (southern platyfish): 111611021
Entry
111611021         CDS       T02923                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xma03036]
    111611021 (ankrd53)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    111611021 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank Trans_coact
Other DBs
NCBI-GeneID: 111611021
NCBI-ProteinID: XP_023202365
Position
14
AA seq 400 aa
MLANKIKSSLLASLLRFCSSVTVVLPRRKSSRKASSGEPVLPDVDPDSTELLAEEKLSAL
HIACLYGELHTIQLIIKARPLWVNLGDSKGRRPLHIVLSSQRFSNTYTIFKYLMEQGADI
NAATNSGETPLHTAASRGLLSCTEMLVKAGADILARDKMGLTPLDMAHIWNHRKTARYLK
HCLWYCEKQDEMEETQLTQMLYRELIDLVKQKNLNEKSLIEEKVEEWAKKRGLSPLKTLT
PRSKASKYHNNCSSPEKSKRQPKPTKGESKRIQEKKDVSKAQQPPLPDSPWTVFGLHPEK
PCTDPDLRKDVMLLKNSINQRLHYTTKWDTAPHLAPDLPLDKIQRLLFPRAFSSRLNTPW
DFEPRDIKKVQHKGFPQGRSTSPWTEVVMHLVEVLELGHY
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgttggcaaataaaataaaatcctccctactagcttcacttctaaggttctgcagctct
gtcactgtggttttgcctcgcaggaagagttcccgtaaagcttcatctggtgagccggta
ctgccagatgttgatcctgacagcactgagctgctggcggaggagaaactctcagccctc
catatagcttgcctgtatggtgaactgcatactatccagctcataataaaggccaggccg
ttgtgggtcaacctcggtgattctaaaggtcgccggcccctgcacatcgttctgtcctca
cagcggttctccaacacatacaccattttcaaatacctgatggagcaaggagctgatatc
aacgctgcaacaaattcaggggaaaccccgctgcacactgccgccagcaggggcctcctc
agctgcacagaaatgctcgtgaaggccggagcggatattttggcaagggacaaaatggga
ctgacgcctctggacatggcgcacatctggaaccacaggaagacagcacggtacttgaag
cactgcttgtggtattgcgaaaagcaggacgaaatggaggagacacagttgactcagatg
ttatacagagagctcatagatctggtcaagcagaaaaatctgaatgaaaagtcccttatt
gaagagaaggttgaagagtgggcaaagaagagaggcttgtctccgttgaagacgctcacg
cccagatccaaggcgtccaaataccacaataactgcagctcaccagagaagagcaagagg
caaccaaaacctaccaagggagagtccaaacgcattcaagaaaagaaggacgtctccaaa
gcacagcagccccccttacccgacagtccctggactgtctttggcctccacccagagaaa
ccctgcacagacccagacctcaggaaagatgtcatgttgttgaagaacagcatcaaccag
aggcttcactacacgaccaagtgggacacagcgcctcacctcgctcccgacctgcctctg
gacaagattcagagattgttgtttcccagagcgttttcttctcggctcaacacgccatgg
gactttgagccgcgggacatcaagaaagtccagcacaaaggtttccctcagggaaggagc
acctctccctggacagaggtggtcatgcacctggttgaggtcctggagctgggacactac
tag

DBGET integrated database retrieval system