KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0020Help
Entry
XNC1_0020         CDS       T01274                                 

Gene name
hsdM
Definition
(GenBank) Type I restriction-modification enzyme subunit M
  KO
K03427  type I restriction enzyme M protein [EC:2.1.1.72]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:xne02048]
    XNC1_0020 (hsdM)
Enzymes [BR:xne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     XNC1_0020 (hsdM)
Prokaryotic defense system [BR:xne02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   XNC1_0020 (hsdM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N6_Mtase HsdM_N DUF1943 Eco57I YtxH MTS Methyltransf_31 UPF0020 Taxilin GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: CBJ88113
UniProt: D3VG23
Position
complement(20538..22997)
Genome map
AA seq 819 aa AA seqDB search
MAIKKNELYSSLWASCDELRGGMDASQYKDYVLTMLFMKYVSDKYKNDRYGIIVIPEGAS
FDDMVALKGKKEIGDKINKIIRKLADENRLGTMFDVANFNDEEKLGKGKEMIDRLSKLVG
IFEGLDLSNNYAGGDDLMGDAYEYLMRHFATESGKSKGQFYTPAEVSLVLAKIIGINDKT
PRDASVYDPTCGSGSLLLKASDEAPRGLSIFGQEMDVTTSSLAKMNMILHGHESDVHSIQ
QGNTIASPVFKDDKGQLKTFDFAVANPPFSNKNWTSGINPREDEFGRFGWGIPPEKNGDY
AFLLHILKSLKSTGKGAVILPHGVLFRGNAESLIRENLIKQGYIKGIIGLPANLFYGTGI
PACIIVLDKQDAISADFDAEGKVTRGRDIFMIDASRGFIKDGNKNRLRSQDIYKIVEVFT
QQKTLPRFSRVVEFKEIVENDYNLNIPRYIDSSEPEDLHDLSAHLQGGIPNRDIDALDKY
WNIFPDIRSTLFAPEREGYSRSLVDANQVKNTILSHAEFKTFAEQSLKPFATWCQSAALK
EIRLKDKPKELIHEISEALLIRYESLPLLSKYDVYQILMDYWAETMQDDVYVLVQDDWKA
GKKVRELVVKQAEKLKETPDFVIKKTKYKAEIIPPALIIQNYFAGQQVKIDQLQIDADNA
TQALENYIEENSGDDGLLNDALNDKDKVTKASIAARLKLATDNEEKTVLKQAKELFDAEI
DAKKALKKYQEALDLSVLKQYSKLTDDEIKTLVVDKKWLATLEANIQAEIERVTQQLTNR
VRELEERYAEPLPKINESVEEISKKVAEHLKDMGLEWTL
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaaaaagaacgaactctattcctcattgtgggctagctgcgatgagctgcgt
ggcggtatggatgccagccagtacaaagactacgtactgaccatgctgtttatgaagtat
gtgtccgataagtacaaaaatgatcgttacggcattattgttattcctgaaggtgccagt
tttgacgatatggttgctctgaaaggcaagaaagaaatcggtgataaaatcaataagatt
atccgcaaattagctgatgaaaatagattaggaaccatgtttgatgttgccaactttaac
gatgaagaaaagcttggtaaaggcaaagagatgattgaccgcctttccaaactggtcggt
atttttgaagggttggatctctccaataattatgctggtggcgatgatttaatgggtgat
gcctatgaatatctgatgcgccacttcgcaactgaatctggcaaatcaaaaggacagttt
tatactcctgcggaagtttcgttagttctggcaaagattataggaataaacgacaaaact
ccgcgtgatgcttctgtgtatgacccaacctgcggttcaggttctttgcttcttaaagcg
agtgatgaagcaccgcgtggattaagtatctttggtcaggagatggatgtgaccacttca
tcactggcaaaaatgaatatgattctgcatggtcatgaatctgatgttcatagtattcag
cagggtaacaccattgcctctcctgtatttaaagatgataaaggacagcttaaaactttt
gatttcgccgtagcgaatcctcctttttctaataaaaactggaccagtggtattaacccg
agagaagatgaatttggtcgttttggttggggaattccaccagagaaaaacggtgattat
gcctttttattgcacatcctcaagagcctgaaaagtacaggtaaaggggctgtaatcttg
cctcacggtgtattgtttcgtggtaatgctgaatccctgattcgtgaaaacctgataaag
cagggttacattaaaggtattattggtcttccggcaaacctgttttatggcacagggatt
ccggcctgtattattgtgctggataagcaggatgccatttctgctgattttgatgcagaa
gggaaagttacccgtgggcgtgatatttttatgattgacgcaagccggggttttataaaa
gacggcaacaaaaaccgtctgcgcagtcaggatatttacaaaattgttgaagtttttact
caacagaaaacattgccacgttttagccgagtagttgaatttaaagagatagtagagaac
gactacaacctcaatatccctcgttatatcgacagtagtgaaccggaagatttgcacgat
ctcagtgctcatctgcaaggggggattcctaaccgtgatattgacgcgttggataaatac
tggaatatttttcccgacattcgctccacactatttgcaccagagcgcgaggggtacagc
cgcagcttagtagatgccaatcaggtgaaaaacacgattctcagtcatgcagaatttaaa
actttcgcggaacaaagcctgaaaccgtttgccacatggtgtcaatctgctgcattgaaa
gaaatccgtcttaaagataaacctaaagagctgattcatgaaatcagtgaagctttgttg
attcgttatgaatcattgccgctgttgagcaagtacgatgtttaccagatcctgatggat
tattgggcagagacgatgcaggacgatgtttatgtgctggtacaagatgattggaaagca
ggtaaaaaggtacgtgagctggtagtaaaacaagctgaaaaactgaaagaaactccggat
tttgtgatcaaaaaaactaagtacaaagctgaaattattcctccggcattgattatccag
aattactttgcagggcaacaggtaaaaatcgatcaattacaaattgatgcggataatgca
acacaagcgctagaaaactatatcgaagaaaacagcggcgatgatggcctgctgaatgat
gccctgaatgacaaagataaagtgaccaaagcaagtattgctgctcgcctgaaactggca
actgacaatgaagaaaaaacagtactgaaacaggcaaaagagctatttgatgctgaaata
gacgctaaaaaagcgctgaaaaaatatcaggaagctctggatttatcggtacttaagcaa
tactcaaaactcactgatgatgagatcaaaacgttggtggtggataagaaatggctggca
acattggaagctaatattcaggctgagattgagcgtgtaactcaacaactgacaaaccgt
gtcagagaactggaagaacgctatgccgagccgctgcctaaaattaacgaatcagttgaa
gaaataagcaaaaaagttgccgaacacctgaaagatatggggttagaatggacgttgtga

DBGET integrated database retrieval system