KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0062Help
Entry
XNC1_0062         CDS       T01274                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01130  Biosynthesis of antibiotics
xne01230  Biosynthesis of amino acids
Module
xne_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XNC1_0062 (aroK)
Enzymes [BR:xne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     XNC1_0062 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_22 AAA_16 AAA ABC_tran TsaE AAA_25 APS_kinase AAA_7 AAA_5 AAA_17 AAA_28 Ploopntkinase3 RNA_helicase AAA_PrkA His_biosynth RsgA_GTPase AAA_29 AAA_2 PduV-EutP AAA_14 GTP_EFTU AAA_24 Mg_chelatase IstB_IS21 DUF1318
Motif
Other DBs
NCBI-ProteinID: CBJ88150
UniProt: D3VG60
Position
complement(65315..65836)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIERRTGADVGWVFDVEGEEGFR
DREEKIINELTEKQGIVLATGGGSVKSKETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDTPAREVLENLADERNPLYEEIADVTIRTDEQSAKVVANQIIELLEKN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggtcgtcagttagctcagcaactcaatatggagttttacgactctgatcaagaaattgag
cgacgtaccggagctgacgtgggctgggtatttgatgtggaaggcgaagaaggcttccgc
gaccgcgaagaaaaaataattaacgaactgactgaaaaacaaggcattgtattggctacc
ggagggggttcagttaaatcgaaagaaacccgcaatcgcctgtctgcccgtggtgtggtc
gtctatttagaaacaaccatcgaaaaacagttagctcgtacccagcgcgacaaaaaacgc
cctttacttcaagttgatacaccagcacgtgaagttttagaaaatttggctgatgagcgt
aatcctctttacgaggaaattgctgacgtgactattcgtacggatgagcaaagcgccaaa
gtcgtcgctaaccaaatcattgaattattggaaaagaactga

KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1257Help
Entry
XNC1_1257         CDS       T01274                                 

Gene name
aroL
Definition
(GenBank) shikimate kinase II
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01130  Biosynthesis of antibiotics
xne01230  Biosynthesis of amino acids
Module
xne_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XNC1_1257 (aroL)
Enzymes [BR:xne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     XNC1_1257 (aroL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 AAA_16 Thymidylate_kin AAA_14 Rad17 Cytidylate_kin AAA_24 AAA ABC_tran AAA_5 AAA_17 AAA_22 Mg_chelatase Cnd3 AAA_28
Motif
Other DBs
NCBI-ProteinID: CBJ89328
UniProt: D3V9U0
Position
1121169..1121699
Genome map
AA seq 176 aa AA seqDB search
MKQALFIVGARGAGKTTIGKLLAEILSYKFIDTDESLQISSKMTIADLVALHGWEYFRQL
ESQTLKTVSQSGCVISTGGGMVLSQENRHYMQQHGIVIYLQTSAEVLSNRLSLNPENSQR
PSLTGKSIIEEIEDILVAREPLYSGCADLTVDASLSKENIVTSIKNYILTRKNKII
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggctctatttatcgtaggcgcacgtggtgcagggaagacgacaataggaaag
ttgttggctgaaatattgtcgtacaaatttattgacactgatgagagtctgcaaatctcc
agtaaaatgacaattgctgatcttgttgcactgcatggctgggaatatttccggcaactg
gaaagccagacattgaaaacagtgagccaaagtggatgtgtcatttcaaccgggggtggg
atggtactgtcacaggaaaatcgtcattatatgcagcaacatggcattgtgatttattta
caaacatccgcagaagttttaagtaatcgattatctcttaacccagaaaattcacaacgc
cctagcttgacagggaaatcaatcattgaagaaattgaggacatattggttgcaagagaa
ccattatacagtgggtgtgctgatctcactgtagatgccagtttgtcaaaagaaaatatc
gtaactagcattaagaattacattttgacccggaaaaataaaataatttaa

DBGET integrated database retrieval system