KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0113Help
Entry
XNC1_0113         CDS       T01274                                 

Definition
(GenBank) Acetyltransferases
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00520  Amino sugar and nucleotide sugar metabolism
xne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XNC1_0113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:xne01005]
    XNC1_0113
Enzymes [BR:xne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     XNC1_0113
Lipopolysaccharide biosynthesis proteins [BR:xne01005]
 Unusual sugar
  XNC1_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: CBJ88201
UniProt: D3VGB1
Position
108905..109495
Genome map
AA seq 196 aa AA seqDB search
MSIIEEVMVHTSAIVDDGAQIGKNSRIWHFTHVCSGARIGEGCSLGQNVFIGNKVIIGSH
CKIQNNVSIYDNVYLEDGVFCGPSMVFTNVYNPRSFIERKNDYKDTLVKKGATLGANCTI
VCGTTIGSYAFIGAGAVVNKDVPDYALMVGVPAKQIGWMSEFGEQLDLPLHGKASTTCPY
TGHVYQLDDNSVKRIK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataatagaagaagtcatggttcatacaagtgccattgttgatgatggtgctcaa
ataggaaaaaatagccgaatctggcattttacacatgtctgttctggagccagaattggt
gaaggttgttctctgggtcaaaacgtatttattggaaataaagtcattattggaagtcac
tgcaaaatacaaaataatgtctccatctatgataatgtgtatttagaagatggtgtcttt
tgtggcccaagtatggttttcactaatgtctataatcctcgttctttcatcgaaagaaag
aatgactataaagataccttagtaaaaaaaggagcaactttaggtgctaactgtacaata
gtttgtggaacaactattggttcttatgcttttatcggcgctggtgccgttgtcaataaa
gatgttcctgattatgcattaatggttggagtacctgcaaaacaaatcggttggatgagt
gaatttggtgagcagctagatctgccattacatggaaaagcctctacaacgtgcccttat
actggtcatgtttatcaattagatgataacagtgtaaaaagaattaaataa

DBGET integrated database retrieval system