KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0228Help
Entry
XNC1_0228         CDS       T01274                                 

Gene name
metL
Definition
(GenBank) bifunctional: aspartokinase II (N-terminal); homoserine dehydrogenase II (C-terminal), methionine sensitive
  KO
K12525  bifunctional aspartokinase / homoserine dehydrogenase 2 [EC:2.7.2.4 1.1.1.3]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00260  Glycine, serine and threonine metabolism
xne00261  Monobactam biosynthesis
xne00270  Cysteine and methionine metabolism
xne00300  Lysine biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01230  Biosynthesis of amino acids
Module
xne_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
xne_M00017  Methionine biosynthesis, apartate => homoserine => methionine
xne_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_0228 (metL)
   00270 Cysteine and methionine metabolism
    XNC1_0228 (metL)
   00300 Lysine biosynthesis
    XNC1_0228 (metL)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    XNC1_0228 (metL)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     XNC1_0228 (metL)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     XNC1_0228 (metL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh AA_kinase NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CBJ88316
UniProt: D3VH31
Position
200753..203188
Genome map
AA seq 811 aa AA seqDB search
MSALATAEAGFDRQLHKFGGSSLADVRCYQRVAEIMMNYSQPGDLMVVSAAGSTTNLLID
WLRLSQSDRISAHQMQQSLRRYQQELIRGLLPETVAEELVTMFIADLERLSALLDKPVTD
ITYAEVVGHGEIWSARLMAAVLEQKGVPSTWLDARQFLRAERVAQPQVDVNLSQPLLDQL
LSQHPNKRLVVTGFISSNQNGETVLLGRNGSDYSATQVGALAGAKKVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSVSDIDLQLRCSYQPEQGSTRIE
RVLATGTGAKIVTSHDDVCLIELHVSSAHDFKQIYKDIDSLLKRTQIKPLATGLHADCNL
IQLCYTSEVVNSALDVLQDASVPGKLSLREGLALVALVGAGVCKNPLHSHRFYQQLKDQP
VEFVWHAEEGISLVAVLRLNQTSHLIQGLHQSLFRAEKRIGLVLFGKGNIGSRWLELFAR
EQKNISARSDFEFILAGVVDSRRSLLNYQGIDASRALAFFNDEAIEHEDDSLFLWMRAHP
YDDLVVLDVTASEELAKEYIGFASYGFHVISANKIAGSSDSNTYRMIRDAFAKTGRHWLY
NATVGAGLPVNYSVRDLRESGDAILSISGIFSGTLSWLFLQFDGSVPFSDLVEQAWQQGL
TEPDPRIDLSGQDVRRKLVILAREAGYEIEPDQVRVESLVPQEANLGSVEEFFENSTAVN
AQMLQRLEAAREMGMVLRYVARFDVSGKAKVGVEAVRSDHPLASLLPGDNVFAIESRWYR
DNPLVIRGPGAGRDVTAGAIQSDLNRLSQLL
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactggcaacagcggaggcgggatttgaccgccaattacataaatttggcggc
agcagcctggctgatgtgagatgttatcagcgggttgcggaaattatgatgaattatagc
cagccgggcgatttgatggtggtatcggcggcagggagcacaaccaacctgcttattgac
tggttgaggctgagccaaagtgatcggatatcagcccatcaaatgcagcaatcgttgcgg
cgctaccagcaagaattgatccgtgggctgttgccagaaaccgttgcagaagaactggtc
acaatgtttatcgctgatctggaaagactgagtgcactgttggataagcctgttactgat
atcacctatgccgaagttgtcggccacggggaaatctggtctgcgcgcttgatggccgcg
gtacttgaacagaagggcgttcccagtacgtggttggatgcccgccagttcctgcgggca
gaacgtgttgcccagccgcaggtcgatgtgaatttgtctcagcctctgcttgatcagcta
ttgagccaacaccccaataagcgattggtggttaccggttttatttccagtaatcaaaac
ggggaaacggtattgctgggacgcaatggcagtgactattcggctacacaggttggcgca
ctggcgggggctaaaaaagtcacgatttggagcgatgtagcaggtgtctacagtgctgac
ccacgtaaagttaaagatgcgtgcctgctgccattgctgcgtctggatgaagccagtgaa
ttggcgcgtctggcggcacctgtgcttcatacccgcacgttgcagcctgtttctgtcagt
gatattgatctgcaactgcgttgcagttatcagccagaacagggttctacccgtattgag
cgcgtattggcgacagggactggcgcgaaaattgtcaccagtcatgatgatgtctgcctg
atcgagttacatgtttcctcagcgcatgatttcaagcagatttacaaggatattgattca
ctgctgaaacgcacccaaattaaaccgttggcgaccggactgcatgcggattgtaatctg
atccagctttgttatacctctgaagttgtcaacagtgccctggatgttttacaagatgct
tctgtaccgggaaaactttccttgcgtgaagggttggcgctggtcgcactggtgggggcg
ggagtatgtaaaaatccgctgcatagccatcgtttttatcaacaattaaaagatcagcct
gttgaatttgtctggcatgccgaagagggtatcagtcttgttgctgttttacgcctgaac
cagacttcccatttgattcagggattgcaccaaagcttgttccgggcagaaaagcgcatt
ggtttggtgctgtttggcaaaggaaacatcggttcacgttggttagaactgtttgcacgt
gaacagaagaatatttctgcccgcagtgattttgagtttattctggcaggggtggtggac
agccgccggagtttgctgaattatcagggcattgatgccagccgagcgttggcatttttt
aatgatgaagcgatcgagcatgaagacgactctctgtttctatggatgagagcacatcct
tatgatgatctggtggtactggatgtcacggcgagtgaagaattggccaaagagtatatt
ggttttgccagctacggttttcatgtgatcagtgccaacaaaattgccggctcttctgac
agcaatacataccgcatgatccgtgatgcctttgcaaaaacagggcgacactggttatac
aatgccaccgttggtgccggattgccggttaattattccgtcagggatttgcgggaaagc
ggcgatgcgattttatccatcagtggcattttttcaggaacattatcatggctgttcttg
cagtttgatggttccgtgcctttcagtgacttggttgaacaagcatggcagcagggcttg
acggagcctgatccgcgtattgacctttccggtcaggatgtcaggcgtaagctggttatt
ctggctcgtgaagcgggttatgagatagagcctgatcaagtccgtgttgaatcactggtt
ccgcaagaagcaaatctcggttctgttgaagaattctttgaaaacagtacggcggtcaat
gcgcagatgcttcagcgattggaagcggcacgggagatgggcatggtgttgcgttatgtc
gcgcgttttgatgtcagcggtaaagcgaaagtgggtgtggaagcggtacgcagtgatcac
ccgttagcttcattgttgccgggggataatgtttttgcgatagaaagtcggtggtatcgc
gataatccgctggtgatccgtggccctggtgctgggcgggatgtgactgccggcgctatc
caatcagatttaaatcgcttgtcacagctcttgtag

KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0692Help
Entry
XNC1_0692         CDS       T01274                                 

Gene name
thrA
Definition
(GenBank) bifunctional: aspartokinase I (N-terminal); homoserine dehydrogenase I (C-terminal), threonine sensitive
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00260  Glycine, serine and threonine metabolism
xne00261  Monobactam biosynthesis
xne00270  Cysteine and methionine metabolism
xne00300  Lysine biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01230  Biosynthesis of amino acids
Module
xne_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
xne_M00017  Methionine biosynthesis, apartate => homoserine => methionine
xne_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_0692 (thrA)
   00270 Cysteine and methionine metabolism
    XNC1_0692 (thrA)
   00300 Lysine biosynthesis
    XNC1_0692 (thrA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    XNC1_0692 (thrA)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     XNC1_0692 (thrA)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     XNC1_0692 (thrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh AA_kinase NAD_binding_3 ACT_7 ACT
Motif
Other DBs
NCBI-ProteinID: CBJ88763
UniProt: D3VJK7
Position
600599..603073
Genome map
AA seq 824 aa AA seqDB search
MRVLKFGGTSVANHQRVLSVADIAENELSLGQVALVLSAPAKITNHLVAMIEKTVAGQDI
VSNISDATQIFTDLLSGLKKHQAGFDYVRLKGIVEREFANLKQILHGISLLQQCPDSINA
ALICCGEKLSIAIMEAVLQARGHQVTVIDPVKNLLAHGHYLESTVDIHESSKRIAERNIP
ADHIILMAGFTAGNENGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRAV
ADARLLKSMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTANPDAPGTLISNGLM
GHGQKDNEMPIKGITNLDHMAMINVSGPGMKGMVGMAARVFSVMSSKGISVVLITQSSSE
YSISFCVPQKELAKAQKALTEEFYLELKDGVLDPIDVINNLAIISVVGDGMRTQRGISAR
FFSALTRANINIIAIAQGSSERSISAVIENSAATTAVRLCHQMLFNTAQIVEVFVVGVGG
VGSALIEQIRRQQAWLKQKHIELRVCGIANSRALLTDMQGICLDNWQQVLSEATEPFSLS
RLIRLEKEYHLLNPVIVDCTSNQAIAEQYASFLSDGFNVVTPNKKANTLSMGYYRQIRQA
AEKSKRKFLYDTNVGAGLPVIENLQNLLNAGDELVQFSGILSGSLSYIFGMLDEGMTLSQ
ATLLAKEKGFTEPDPRDDLSGMDVARKLLILAREAGYELELEDIHVEPVLPASFDANGDV
DNFLQRLPQLDQEFSQRAADAAEQGKVLRYVGLIEQGCCTVRMVAVDGNDPLYKVKNGEN
ALAFYTRYYQPIPLVLRGYGAGNDVTAAGVFADILRTLSWKLGV
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtattgaaatttgggggcacctcagttgccaatcaccagcgagtattgagtgtt
gctgacatcgccgagaatgagttatcccttgggcaagttgctttggttctctcggcacca
gcaaagatcaccaaccatcttgtggcaatgattgaaaaaacggttgcaggacaagatatt
gtttccaatataagcgatgctacccaaatctttactgatttactgtcgggcttgaaaaag
catcaggcagggttcgattatgtccgtctaaaaggcattgtagagcgtgaatttgcaaat
ctgaaacagattctgcatggcatttctctgttgcaacaatgtccagatagcatcaatgca
gcattgatctgttgcggtgaaaaactgtctattgccattatggaggcagtcttacaggct
cgcggccaccaagtgactgtcattgatcccgtcaaaaatctattggcacatggacattat
cttgaatccactgtcgatatccatgaatcttctaaacgcattgctgaacgcaatattcct
gctgaccatattatcctgatggcgggttttaccgcgggtaatgaaaatggagaattagtg
gtactgggacgtaacggttctgattattcagccgcagtgctggcggcatgtctgcgagcc
gattgttgtgaaatctggactgatgtggatggtgtttacacttgcgatccgagagcagtt
gctgatgcccgcttgctgaaaagcatgtcatatcaagaagcgatggaattgtcctatttt
ggtgcaaaagtcctccatccccgcaccattgcccctatcgcccaatttcagattccttgt
ctgattaaaaatactgccaatcctgatgcgcccggtactctgatcagtaatgggctgatg
ggtcatggacaaaaagacaatgagatgccaatcaaaggcattaccaatctggatcatatg
gcgatgatcaacgtctccggccccggaatgaaaggtatggtcgggatggctgcacgggta
ttttccgttatgtccagcaaaggtatttcagttgtcttgatcacccaatcttcgtctgag
tacagcatcagtttctgcgtaccacaaaaagagttggcgaaagcgcagaaggcactgaca
gaagagttttatctggaactgaaagatggtgtgcttgatccgattgatgtgataaataac
cttgccattatctctgtcgttggggacggtatgcgtacccagcgtgggatttcggcccgt
ttcttctccgcattgacacgcgccaatatcaatatcattgcgattgcgcagggatcttct
gagcgttccatttccgccgtcattgaaaatagtgcggcaacgacagcggttcggctttgc
caccaaatgctgtttaacaccgcacaaatcgtcgaagtcttcgttgtcggtgtgggaggt
gtcggcagtgcactgatagagcaaatccgtcgccaacaggcgtggctcaaacaaaagcac
attgaattacgtgtctgcggtattgccaactcccgtgccctgttgaccgatatgcagggt
atttgtttggataactggcaacaagtgctttcagaagccactgagccatttagcctgagc
cgcttgatccgccttgaaaaggagtaccaccttctgaatccggtcattgttgactgtact
tccaatcaggcgattgcggaacaatacgccagctttctcagcgatggttttaacgttgtt
acaccgaataaaaaagccaatacattatctatggggtattaccgccaaatccgtcaggcg
gctgagaaatccaaacgcaagttcttgtatgacacaaacgtaggtgcgggattacccgtt
atcgaaaacttgcagaacctgcttaatgcaggggatgaattagtgcaattcagcggcatt
ttgtcgggttctctctcctatatcttcggcatgctcgatgaaggaatgaccctttcacaa
gctaccttgctggcgaaagagaaaggctttactgaacctgatccacgcgatgatctctcc
ggaatggatgttgcccgcaagctactgattctggcacgtgaagcgggttatgaactggag
ttagaagatatccacgtagaacctgtattgcctgcttcgttcgatgccaatggtgatgtc
gataatttcctgcaacgtttgccgcaactggatcaggaattcagccaacgtgcagcagat
gcagcagaacaagggaaagttttgcgttatgttggtctgattgagcaaggttgttgtact
gtgagaatggtcgctgttgacggcaatgatccgctttataaagtcaaaaatggtgaaaac
gcgctggctttctatacccgttattatcaacctatcccgctggtcctgcgtggttatggt
gcggggaatgatgttacagcagccggtgtttttgctgatatattacgcactttgtcatgg
aaattgggggtttaa

KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3941Help
Entry
XNC1_3941         CDS       T01274                                 

Gene name
lysC
Definition
(GenBank) aspartokinase III, lysine sensitive
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00260  Glycine, serine and threonine metabolism
xne00261  Monobactam biosynthesis
xne00270  Cysteine and methionine metabolism
xne00300  Lysine biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01210  2-Oxocarboxylic acid metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
xne_M00017  Methionine biosynthesis, apartate => homoserine => methionine
xne_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_3941 (lysC)
   00270 Cysteine and methionine metabolism
    XNC1_3941 (lysC)
   00300 Lysine biosynthesis
    XNC1_3941 (lysC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    XNC1_3941 (lysC)
Enzymes [BR:xne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     XNC1_3941 (lysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CBJ91969
UniProt: D3VBY0
Position
3806308..3807681
Genome map
AA seq 457 aa AA seqDB search
MYAVSSPHSQYVVAKFGGTSVADFDAMNNCADIILANTKVRVVVLSASAGVTNLLIALAA
GCDSDKRENHLKQIRDIQYAIIERLNTTDVIREEIDRLLENIETISEAASLATSDALTDE
LVSHGEIMSTLLFVELLRQRNTDAEWFDIRRIMRTNNIFGQAEPDTLQLHALTMEHLHSR
LDNTIVITQGFIGREEKGRTTTLGRGGSDYTAALLGEALGLHRVDIWTDVPGIYTTDPRV
APTAKRIDRIAFDEAAEMATFGAKILHPATLLPAVRCGIPVFVGSSKDPKAGGTIVCDKI
GNPPLYRALALRRKQTLLTLHSLKMLHARGFLAEVFTLLSRHNISVDLITTSEVSIALTL
DTTGSTSTNGSLLTNALLTELSTLCHVEVEEDMALVAIIGNELSRAKGLGKEIFGTLESF
NIRMISCGASSHNVCLLVPGKDAEQVIQTLHRGLFES
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctgtttcgtctcctcattcacaatatgttgtagcaaaattcgggggtactagt
gtggcagattttgatgccatgaataactgtgccgacattattttggcaaacaccaaagtc
cgagtggttgtcctgtctgcgtctgctggcgtaaccaatttgctgattgcactggcggca
ggttgtgatagtgataaacgggagaatcatctgaaacagattcgtgatattcaatatgcc
atcattgagcgattgaatacaacggatgtgatccgagaagaaattgatcgcctgctggaa
aatattgagacaatatcagaagccgcatcgctcgcaacttctgatgcactgaccgatgaa
ttagttagccacggtgaaatcatgtccactttgctgtttgtggaattgctgcgccaacgc
aatacagacgccgaatggtttgatatccgtcgcatcatgcgcactaataatatttttggg
caggcagaaccagacactcttcagcttcatgctttgacaatggaacatcttcattctcgt
ctggacaataccatcgttatcacacaaggctttattggccgggaagaaaaaggccggaca
acaacattgggacggggaggcagtgattataccgccgctttgttgggagaagcacttgga
ttacatcgtgttgatatctggacagatgttccgggtatttacacaaccgatccccgtgtt
gcgcctaccgctaaacgcattgatagaattgcttttgatgaagccgctgagatggcaaca
ttcggtgccaaaatccttcatccggcgacattattgccagcggtacgttgcggtataccg
gtttttgttggctccagcaaagacccaaaagcaggtggtactatcgtttgtgataaaatc
ggcaacccaccgctatatcgagcactggcgttacgccgcaagcaaactttactgacactt
cacagcctgaaaatgctgcatgcaagaggctttcttgcggaagtttttaccctgctttcg
cgccataatatttcagtggatctgattaccacatcagaagtgagcatcgccctgactctg
gatacaaccggctccaccagcacgaatggcagcctgctgactaatgctttgctgactgag
ctttccacattatgtcacgtagaagtggaagaagatatggcactggtggcaattatcggt
aatgaactttcacgggccaaagggttaggcaaagaaatttttggcacactggaatcattc
aatattcgcatgatcagctgtggcgcgagcagccataatgtctgtttgctggttcccggt
aaagatgcagaacaggtgatccagacgctgcatcggggtttgtttgaatcttaa

DBGET integrated database retrieval system