KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0370Help
Entry
XNC1_0370         CDS       T01274                                 

Gene name
ilvE
Definition
(GenBank) branched-chain amino-acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00270  Cysteine and methionine metabolism
xne00280  Valine, leucine and isoleucine degradation
xne00290  Valine, leucine and isoleucine biosynthesis
xne00770  Pantothenate and CoA biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01130  Biosynthesis of antibiotics
xne01210  2-Oxocarboxylic acid metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
xne_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XNC1_0370 (ilvE)
   00280 Valine, leucine and isoleucine degradation
    XNC1_0370 (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    XNC1_0370 (ilvE)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    XNC1_0370 (ilvE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xne01007]
    XNC1_0370 (ilvE)
Enzymes [BR:xne01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     XNC1_0370 (ilvE)
Amino acid related enzymes [BR:xne01007]
 Aminotransferase (transaminase)
  Class IV
   XNC1_0370 (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: CBJ88447
UniProt: D3VHV8
Position
301348..302274
Genome map
AA seq 308 aa AA seqDB search
MTKQADYIWFNGEMVPWADAKVHVMSHALHYGTSVFEGIRCYDSYKGPVVFRHREHMQRL
HDSAKIYRFPVSQNVDELMEACRETLRKNKLVSAYIRPLVFIGDVGMGVNPPAGYKTDVI
IAAFPWGAYLGEEALEQGIDAMVSSWNRAAANTIPTAAKAGGNYLSSLLVGSEARRHGYQ
EGIALDIHGYISEGAGENLFEVKDGILFTPPFTSSALPGITRDAIIKLAQDLGLEVREQT
LSRESLYLADEVFMTGTAAEITPVRSVDDIQVGIGKCGPITKKIQNAFFGLFDGTTEDKW
GWLDPVNP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcaagctgattatatttggttcaatggagaaatggtaccttgggcagatgct
aaagtgcacgttatgtcccatgccttgcattatggtacttcagtctttgagggcattcgc
tgttatgactcttacaaagggcctgttgtttttcgccatcgtgaacatatgcagcgcttg
catgactcagccaagatttatcgtttcccagtgagtcagaatgttgatgaactgatggaa
gcgtgtcgtgaaacccttcgtaaaaataaattagtcagtgcttacattcggccgttggta
tttattggtgatgttggcatgggcgttaatccgcctgctggttacaaaacagacgttatt
attgctgcttttccttggggcgcttatctgggtgaagaagcgctggagcagggcattgat
gcgatggtttcttcatggaaccgtgccgcggcaaatacgatccctacggcggcaaaagcg
ggaggaaattatctctcatccttattggtcggaagtgaagcccgacgtcatggttatcag
gaagggattgcactggatattcatggctatatttcagaaggcgcgggtgaaaacctgttt
gaagtgaaagacgggattttgtttacgcctccatttacttcatctgcgctgccggggatc
actcgcgatgccattattaaattggctcaggatctgggtctggaagtgcgtgagcagaca
ctttcccgtgaatcactctatctggcagatgaagtattcatgaccgggactgcggcggaa
atcacgccagttcgtagtgtggatgatattcaggttggtattggtaaatgtggtcctatc
accaaaaaaattcaaaacgcattttttggtttatttgatggtacgacagaagataaatgg
ggctggttggatcccgttaacccttaa

DBGET integrated database retrieval system