KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0405Help
Entry
XNC1_0405         CDS       T01274                                 

Gene name
hemC
Definition
(GenBank) hydroxymethylbilane synthase (porphobilinogen deaminase)
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00860  Porphyrin and chlorophyll metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
Module
xne_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
xne_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNC1_0405 (hemC)
Enzymes [BR:xne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     XNC1_0405 (hemC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porphobil_deam Porphobil_deamC
Motif
Other DBs
NCBI-ProteinID: CBJ88482
UniProt: D3VHZ3
Position
complement(337937..338878)
Genome map
AA seq 313 aa AA seqDB search
MTMKTIRIATRQSPLAMWQAHYVQKQLQHFHPELKVELVPMVTRGDIILDTPLAKVGGKG
LFVKELELALLEKRADIAVHSMKDVPVEFPNGLGLVTICERDDPRDAFVSVKYASLDDLP
TGSVVGTSSLRRQCQLRQLRPDLVIRDLRGNVGTRLSKLDNGDYDAIILATAGLKRLGLE
ERIRMPLAPELLLPAVGQGAVGIECRLDDQQTRELLAPLNHARTEICVLAERAMNTRLEG
GCQVPIGSYAIWQEDKIWLRALVGAPDGTVSVRGERVVSPEEARQAGVALAEELLEKGAR
QILASVYQRNPPE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaaaaccattcgtatcgccacccgccaaagtccattggctatgtggcaagcc
cactatgttcaaaaacaactgcaacattttcaccctgaactgaaagtcgaattagttccg
atggtgacacgtggtgacattatccttgatactcccttagccaaggtcggtggtaagggg
ctgtttgtgaaagaactggaactggctctgcttgaaaaacgtgccgatatcgccgtccat
tcgatgaaagatgttcctgtcgagtttcccaacggtttggggttggtcacaatctgcgaa
cgggatgatccacgggatgcttttgtttcagtaaaatacgcctctcttgatgatctgccc
acaggcagcgttgttggcacatccagcctacgccgccagtgtcagctccgtcagctccgt
ccagatcttgtgatccgtgacttgcgcggaaatgtcggtactcgcctgagtaaactcgat
aacggcgattatgatgccattatccttgcaactgccggcttgaaaaggctggggctggaa
gagcgcattcgtatgccattggcgccggagttactgctgccagctgtcggacagggagcg
gttggtattgaatgtcggcttgatgatcaacaaacccgtgagctgctggcaccgttaaac
cacgccagaacagaaatctgtgtcctggccgaacgcgccatgaacacccggcttgaaggc
ggctgtcaggtgccgattggcagttatgccatctggcaggaagataaaatctggttgcgt
gctctggtcggcgcgcctgatggcacagtaagcgttcgtggtgaaagagtggtatcacca
gaagaagcccgtcaggcgggtgtcgcattggcggaggaattattggaaaaaggcgcccgc
caaattctggccagcgtataccagaggaatccaccggaatga

DBGET integrated database retrieval system