KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0454Help
Entry
XNC1_0454         CDS       T01274                                 

Gene name
miaA
Definition
(GenBank) delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:xne01006]
    XNC1_0454 (miaA)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_0454 (miaA)
Enzymes [BR:xne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     XNC1_0454 (miaA)
Prenyltransferases [BR:xne01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   XNC1_0454 (miaA)
Transfer RNA biogenesis [BR:xne03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    XNC1_0454 (miaA)
 Prokaryotic type
    XNC1_0454 (miaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IPPT IPT AAA_33 AAA_16 Zeta_toxin AAA_18 TIP49 AAA_22 Hydin_ADK Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: CBJ88528
UniProt: D3VIH8
Position
388355..389296
Genome map
AA seq 313 aa AA seqDB search
MSDLKTQHLPTAIFVMGPTASGKTALSIALRQHLPVELVSVDSALIYRGMDIGTAKPSAE
EQAQAPHRLIDILDPAETYSAADFRRDALKEMADITAAGRIPLLVGGTMLYFKALLEGLS
PLPSANPEIRAQIEQQAEERGWDALHQQLQEIDPVAAVRIHPNDPQRLTRALEVFRISGK
TLTELTETAGEILPYHVHQFAIAPASREVLHQRIAARFEQMIKSGFEDEVKALYARRDLH
TDLPSIRCVGYRQMWSYLAGEISHDEMVYRGICATRQLAKRQITWLRSWDNVTWLDSDQP
KQVLNTVIQVIGT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttgaaaactcaacacctgccgacagccattttcgttatggggccaacggct
tcaggaaaaacagcattatcgattgctttgcgtcagcatcttccggttgaattagtcagc
gtagattctgcgttgatctaccggggcatggatatcgggacggcaaaaccttccgcagaa
gaacaagctcaggctcctcatcgtttaattgatattcttgatcctgctgaaacttattcc
gcggctgattttcgtcgcgatgctttgaaagaaatggcagatatcacggcggcggggaga
attccactcttagttggtggaaccatgctatatttcaaagcattattggaaggattatct
ccattaccctcggcaaatcctgagataagggcacagatagaacagcaggctgaggaacgg
ggatgggatgctctgcatcagcaattacaggaaattgatccggtggctgcggtaagaatt
catcctaatgatccacaacgtcttactcgtgcactggaagtttttcgcatttcgggtaaa
actctaactgaattgactgaaacggctggagaaatattgccttatcatgttcatcaattt
gcgatcgctcctgcaagccgtgaagttttgcatcagcggatcgctgcccgttttgaacaa
atgatcaaatcagggtttgaagatgaagtgaaagcactttatgctcgtcgtgatttgcat
acagatttaccttccattcgttgtgtcggttatcgtcagatgtggtcttacctcgcaggc
gaaatatctcatgatgagatggtttatcgtggtatttgtgcgacacgccagctggcgaaa
cgtcagatcacgtggctcaggagttgggacaatgtgacttggttggatagcgatcaacct
aaacaagtacttaatacggtcatacaggttattggtacataa

DBGET integrated database retrieval system