KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0463Help
Entry
XNC1_0463         CDS       T01274                                 

Gene name
rnr
Definition
(GenBank) RNase R, 3'-5' exoribonuclease
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:xne00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    XNC1_0463 (rnr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xne03019]
    XNC1_0463 (rnr)
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_0463 (rnr)
Enzymes [BR:xne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     XNC1_0463 (rnr)
Messenger RNA biogenesis [BR:xne03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     XNC1_0463 (rnr)
Transfer RNA biogenesis [BR:xne03016]
 Prokaryotic type
  tRNA degradation factors
   XNC1_0463 (rnr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB CSD2 OB_RNB HTH_12 S1 RNA_pol_Rbc25 Dimerisation LexA_DNA_bind OB_Dis3
Motif
Other DBs
NCBI-ProteinID: CBJ88537
UniProt: D3VII7
Position
395874..398333
Genome map
AA seq 819 aa AA seqDB search
MSKDPFREREAEKYESPIPSREYILDIISKHTIPVSRQELAQELQLTSADAQEALRRRLR
AMERDGQLVFTRRQCYALPERLDLLKGTVIGHRDGYGFLRAEGHKEDFYLPADQMKMAIH
GDVILAQPLRPDRKGRIEVRIVRVLEPKSSQIVGRYFMDAGMGFVVPDDSRLCFDILIPK
EEVCGARMGNVVVVELMNRPTRRTKAIGKIVEVLGETMGTNMAVEIALRTHEIPHSWPPM
VEKQVASLDENVPESAKQGRIDLRELPLVTIDGEDARDFDDAVYCERKRGGGWRLWVAIA
DVSYYVRPQTVLDTEARSRGNSVYFPSQVVPMLPEVLSNGLCSLNPEVDRLCMVCEMTIS
AQGKLSSYKFYEAVMNSHARLTYTKVWKILQGDQEQREHYKPLVTHIEHLHELYQALEHA
REERGAISFESEEAKFIFNAERRIERIEPVVRNDAHKLIEECMILANIAAARFVEKHHEP
ALYRIHDRPREESILNLRSVFNELGLSLLGGLKPEPKDYAQLMKDVAERPDHELLQTMLL
RSMKQAIYEPENRGHFGLALRAYSHFTSPIRRYPDLALHRAIKYLLSKEKLAQENEVVEH
RWTPTGGWHNDMEHMLQLGDHCSMTERRADEATRDVADWLKCDFMQDQVGNVFTGLITSV
TGFGFFVRLNDLFIDGLVHVSTLDNDYYRYDNVGQRLIGESSGQTYRLGDEVEIRVEAVH
MDERNIDFNLLSTTRKARNQGKTERDKAKKGKPERKNGKKGRDNKKSANFEPDRAFRKKK
KAEEPKSSNKPSKKKKQSDKTQKITANLKAKRAKKSTGE
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatccttttcgggaacgagaggctgaaaaatacgaatctccaatcccaagc
cgtgaatacatcttggatatcatttctaaacacaccattccggtaagccgtcaggaactc
gcacaagaacttcagttaaccagtgctgatgcacaggaagcattgcgccgccgtttgcgg
gcaatggaacgcgatgggcagttggtatttacccgccgtcaatgttatgcgttaccagaa
cgattggatttgttgaaagggacggtaatcggacaccgtgatggctacggtttcctgcgt
gcagaaggccacaaagaagatttttatctgcctgctgaccagatgaaaatggcgatccat
ggtgatgtcattctggcacagccgttgcgcccggacagaaaaggccgcattgaagtgcgg
attgtacgggtattggagccgaagagcagccaaattgttggtcggtattttatggatgca
ggcatgggatttgtcgttcctgatgacagtcgtctgtgttttgatatcttgatccccaaa
gaggaagtttgcggggcaagaatgggtaacgttgtagtggttgaattgatgaatcgccca
acccgccgaaccaaagctattggtaaaatcgtcgaggtgctgggtgagacgatgggcacg
aatatggcggttgaaatcgcacttcgtacccatgaaattccccatagctggccgccaatg
gtagaaaaacaggtggcctccctggatgaaaatgttccggagtctgctaagcaaggccgt
atagatttacgtgagttaccgctggtaacgattgatggcgaagatgcccgtgactttgat
gatgctgtgtattgcgaaagaaaacgcgggggcggctggcgcttgtgggttgcgattgcg
gatgtgagttactacgttcgtccgcaaactgtgttggatacagaagcacgtagccgtggt
aactcggtctatttcccttctcaggttgtaccgatgctaccggaagtgctgtcgaatgga
ttgtgttctctcaatccggaagttgaccgcttgtgtatggtgtgtgaaatgaccatttcc
gctcagggcaagttatcttcctataagttttacgaagcggtgatgaactctcatgcccgt
ttgacttatacgaaagtctggaagattttgcagggcgatcaagagcagagagagcattac
aagccgttggtaacacatattgagcacctgcatgaactttatcaggcgctggaacacgca
cgcgaagagcgtggggctatttcgtttgaatccgaagaagccaaatttatttttaacgca
gaacgtcgcattgagcgtattgaaccggttgtacgcaacgatgcccataaactgattgaa
gagtgtatgattctggctaacattgcggccgcccgctttgttgaaaaacatcatgagcca
gcgttataccgcattcacgatcgtccgagagaagagagtatcctgaatcttcgttcggtc
ttcaatgaactggggttgagcttattgggcggcctgaaaccagagccgaaagattatgcg
caattgatgaaagacgtcgcagagcggccagatcacgaattgctgcaaacaatgctgctg
cgctccatgaaacaggcaatttatgagcctgaaaatcgcggacactttggtctggcgttg
cgtgcttattctcactttacttcaccgatccgccgctatcctgatttggcactgcaccgt
gcgatcaaatatttgttgtcgaaagaaaaattggcacaagaaaatgaggttgttgaacat
cgctggacgccaacgggtggctggcacaacgacatggaacatatgctgcaattgggcgac
cattgctccatgactgagcgccgtgccgacgaagcgacacgggatgtggctgattggctg
aaatgtgatttcatgcaggatcaggtggggaatgtattcaccggattaattaccagcgtg
accggttttggtttcttcgtccgcctgaatgatctgttcattgatggcttggtgcatgtg
tcaacactggataacgattattacagatacgataatgtcggccagcgtttgattggtgaa
tcttcagggcaaacttatcgcttgggtgatgaggttgaaatccgtgtggaagcggttcat
atggatgagcgtaatatcgatttcaacttactttcaacgacacgcaaagcgcgcaatcaa
ggtaagactgagcgtgataaggcgaaaaaaggcaaaccagagcgtaaaaatggtaaaaaa
ggccgtgataataaaaaatcagccaattttgaaccagaccgcgcttttcgcaaaaagaaa
aaagcggaagagccaaagtccagtaataagccaagcaaaaagaaaaaacagtcagataaa
acccaaaaaattacggcaaacctgaaagcgaaacgcgcgaaaaaaagcacgggcgaatag

DBGET integrated database retrieval system