KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0482Help
Entry
XNC1_0482         CDS       T01274                                 

Gene name
fbp
Definition
(GenBank) fructose-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00010  Glycolysis / Gluconeogenesis
xne00030  Pentose phosphate pathway
xne00051  Fructose and mannose metabolism
xne00680  Methane metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
Module
xne_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_0482 (fbp)
   00030 Pentose phosphate pathway
    XNC1_0482 (fbp)
   00051 Fructose and mannose metabolism
    XNC1_0482 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    XNC1_0482 (fbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xne04147]
    XNC1_0482 (fbp)
Enzymes [BR:xne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     XNC1_0482 (fbp)
Exosome [BR:xne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XNC1_0482 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-ProteinID: CBJ88556
UniProt: D3VIK6
Position
complement(415296..416300)
Genome map
AA seq 334 aa AA seqDB search
MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAGLVDILGASGVSNVQGE
VQMKLDLYANEKLKAALKARGEVAGIASEEEDEIVIFDGDRAETAKYVVLMDPLDGSSNI
DVNVSVGTIFSIYHRITPIGQPVTEEDFLQPGHRQVAAGYVVYGSSTMLVYTTGCGVHTF
TYDPSLGVFCLTHEKVQFPAKGNMYSINEGNYIKFPLGVKKYIKYCQEQDEATQRPYTTR
YIGSLVADFHRNLLKGGIYIYPSTASHPTGKLRLLYECNPIAFLAEQAGGKASDGANRIL
EIVPSKLHQRVPFFVGTKSMVEKAESFMAEFPDE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaggcgaattcatcgtcgaaaaacagcaagactttcctcatgctacaggt
gaactgaccgcactactgtctgccatcaaattaggcgctaaaatcattcacagggacatc
aacaaagccggtctggtcgatattttaggtgccagcggtgtctctaatgttcagggtgaa
gttcagatgaaactggacttgtatgccaatgaaaaacttaaggcagcattgaaagcacgc
ggtgaagttgcaggtattgcttctgaggaagaagacgagatcgttatttttgatggcgac
cgtgcagaaactgctaaatatgttgttttgatggatcctttggatggttcttcgaatatt
gatgtaaacgtttctgtcgggactattttctcaatttaccaccggattacgcctatcggg
caacctgtgaccgaagaagatttcctacaacctgggcatcgtcaggtcgcggcaggttat
gtggtttatggctcatccacaatgctggtctatacgacgggttgtggtgttcatacattc
acttacgatccttctcttggtgtcttctgcctgacccatgaaaaagttcaattcccggca
aaaggcaatatgtattctattaacgaagggaactacatcaaattcccattgggcgtgaag
aagtacatcaaatattgccaggaacaggacgaagcaacacaacgcccttataccacccgt
tatattggttctctggttgctgatttccaccgcaacctgctgaagggaggtatctatatt
tacccaagtaccgcaagccatccaacaggcaaattacgtctattgtacgagtgcaatcca
attgcattcttggcagaacaagccgggggaaaagccagtgacggtgcaaaccgtatttta
gagatcgtaccaagcaagctacaccaacgcgttcctttctttgtcggtacaaaatcaatg
gtcgagaaagcagaaagcttcatggccgaatttcctgatgaataa

DBGET integrated database retrieval system