KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0532Help
Entry
XNC1_0532         CDS       T01274                                 

Definition
(GenBank) putative plasmid-related protein
  KO
K18841  mRNA interferase ChpB [EC:3.1.-.-]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:xne02048]
    XNC1_0532
Enzymes [BR:xne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     XNC1_0532
Prokaryotic defense system [BR:xne02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   ChpB-ChpS
    XNC1_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PemK_toxin
Motif
Other DBs
NCBI-ProteinID: CBJ88606
UniProt: D3VIQ6
Position
464216..464590
Genome map
AA seq 124 aa AA seqDB search
MVSRRNVPGKGEIWHTNGNPVSGREFKGADYYLVISEFALNQKLGTALCVPITSGGGPAR
SEAITVYLDGSSTDAGKITGIALCYQIRSLDLNERKATYAAQAEPDIVDEILAKVIDILD
PQLN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtagaaggaacgtcccaggcaagggtgaaatctggcacactaacggcaatcct
gttagcggcagagagttcaaaggggccgattattatctggttatctctgaatttgcactg
aatcaaaagctaggtactgcactttgtgttcccattaccagtggtggaggaccagcacgt
tcagaagctatcaccgtatatctggatggctcaagcactgatgccggaaaaattactggt
attgcactttgctatcagattcgctcacttgatttgaatgaacgcaaagctacctatgcg
gcacaagctgagcctgatattgttgatgaaatcttagctaaagtaatcgatattttggat
cctcaattaaattaa

DBGET integrated database retrieval system