KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0618Help
Entry
XNC1_0618         CDS       T01274                                 

Gene name
hemE
Definition
(GenBank) uroporphyrinogen decarboxylase
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00860  Porphyrin and chlorophyll metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Module
xne_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNC1_0618 (hemE)
Enzymes [BR:xne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     XNC1_0618 (hemE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: URO-D
Motif
Other DBs
NCBI-ProteinID: CBJ88692
UniProt: D3VJD6
Position
529473..530537
Genome map
AA seq 354 aa AA seqDB search
MNELKNDRYLRALLRQPVDITPVWMMRQAGRYLPEYKATRQEAGDFISLCKNTELACEVT
LQPLRRFPLDAAILFSDILTIPDAMGLGLYFEAGEGPRFHAPVMNHADVEKLPVPDPEQE
LGYVMAAVRAIRKALAGQVPLIGFSGSPWTLATYMVEGGSSKAFTKIKAMMYAEPATLHL
LLDKLANSVILYLNAQIKAGAQSVMIFDTWGGVLSHRDYLEFSLHYMHKIVDGLIREHEG
RRVPVTLFTKGGGQWLEAMAATGCDALGLDWITNIADARRRVGDKVALQGNMDPSMLYAA
PARIEEEVSTILHDFGAGAGHVFNLGHGIHQDVPPEHAGAFVEAVHRLSVKYHQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagttgaaaaacgaccgctatctgcgtgccttattacgtcagcctgttgatatc
acgcccgtatggatgatgcgtcaggccggtcgatatttaccagaatataaagcgacgcgt
caggaggcgggagatttcatctcgttatgcaaaaataccgaattagcctgtgaagtgacg
cttcagcctttgcgccgttttcctctggatgctgctatcctcttttctgatatcctgacc
attcctgatgccatgggattggggctttatttcgaagcgggcgagggtccacgtttccac
gctcctgtcatgaatcatgccgatgtggaaaagttaccggttcctgatccagaacaggag
ctgggatatgtcatggccgcagtacgggctatccgcaaggcgttggcaggtcaggtgcct
ttaatcggtttttctggtagtccctggacattggcaacgtatatggttgaaggcggaagc
agcaaggcgtttactaaaattaaagctatgatgtatgctgagccagcgacattgcaccta
ttgctggataaattggcaaacagcgttattctatatttgaatgcgcaaattaaggcgggt
gcgcaatccgtcatgattttcgatacttggggtggcgttttatctcatcgtgattatctg
gaattttccctgcattatatgcataaaatcgtggatggattaatccgcgaacatgaaggt
cgccgtgtccctgttaccctgtttaccaaagggggcgggcaatggcttgaagcgatggcg
gcaacggggtgtgatgcgctcgggctggattggataacgaatattgctgatgcacgtcgt
cgggttggcgataaagtcgctttgcagggcaatatggacccttccatgctgtatgctgca
cccgcacgaattgaagaagaggtttcgacaattttacatgattttggtgcaggcgccggg
catgtgttcaatttgggacatggcattcatcaagatgttccacccgaacatgcgggggca
tttgtcgaagccgtacacaggctttccgtgaaatatcatcaatga

DBGET integrated database retrieval system