KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0759Help
Entry
XNC1_0759         CDS       T01274                                 

Gene name
tgt
Definition
(GenBank) tRNA-guanine transglycosylase
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_0759 (tgt)
Enzymes [BR:xne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     XNC1_0759 (tgt)
Transfer RNA biogenesis [BR:xne03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    XNC1_0759 (tgt)
 Prokaryotic type
    XNC1_0759 (tgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT GPAT_N
Motif
Other DBs
NCBI-ProteinID: CBJ88830
UniProt: D3VK78
Position
656053..657177
Genome map
AA seq 374 aa AA seqDB search
MKFELQKTDGNARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFH
LWLRPGQEIMKLHGDLHDFMQWQGPILTDSGGFQVFSLGAMRKIKEEGVHFRNPINGTPV
FLSPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAARSRQRFDELNNKN
ALFGIIQGSVYEDLRDVSVKGLVEIGFDGYAVGGLAVGEPKEDMHRILEHVCPQIPQDKP
RYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTEGVIKIRNAKHKEDTSSLDE
HCDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGIRKAIEEGKLEQFVEA
FYQQMGKPVPPLNI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatttgagttacaaaagacggatggaaatgcccgtcgtggccgtctggtttttgag
cgtggtgttgtggaaacccccgcatttatgccggtgggaacttacggtacggtaaaaggg
atgacaccggaagaagtgaaagaaacaggagcacagatcctgttgggaaatactttccat
ctttggttacgtccggggcaggaaatcatgaaattgcatggtgacctgcatgattttatg
caatggcagggacctatcctgaccgactccggcggttttcaggttttcagcctcggtgcg
atgcgtaaaatcaaggaagaaggcgttcacttccgtaacccaatcaatggaacgccggtt
ttcctcagtccagaaaaatcaatggaaatccaatatgatttgggttccgatattgtcatg
atttttgatgaatgtacgccataccctgccgattgggattatgcgaagcgttctatggaa
atgtcattgcgttgggccgcacgcagtcgccagcgttttgatgagctgaataataaaaat
gcgctgtttggtatcattcagggcagtgtttatgaagatttgcgtgatgtttccgtaaaa
ggactggtggaaatcggctttgacggctacgctgtgggtggtctggccgtgggtgaaccc
aaagaagacatgcaccgtattctggagcatgtttgtccgcagatcccgcaggataagccc
cgctatctgatgggagtgggtaaaccggaggatttggttgaaggtgttcgccgcggcatt
gatatgtttgactgtgtaatgccaacacgtaatgcccgcaatggtcatctgtttgtgaca
gaaggggttatcaaaatccgcaatgccaaacataaggaagatacttcttcgttggatgaa
cattgtgactgctatacgtgtcgcaattatagtcgtgcatacctccatcaccttgatcgt
tgtaacgaaattcttggtgccagactaaatacgatacataatctaaggtattatcagcgt
ttgatggccggcattcgcaaagccattgaagagggtaaactggaacagtttgtggaagcg
ttttatcagcagatgggtaaaccggttccgccgttaaatatataa

DBGET integrated database retrieval system