KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0891Help
Entry
XNC1_0891         CDS       T01274                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase (aminomutase), PLP-dependent
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00860  Porphyrin and chlorophyll metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
Module
xne_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
xne_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNC1_0891 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xne01007]
    XNC1_0891 (hemL)
Enzymes [BR:xne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     XNC1_0891 (hemL)
Amino acid related enzymes [BR:xne01007]
 Aminotransferase (transaminase)
  Class III
   XNC1_0891 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CBJ88962
UniProt: D3VL03
Position
763162..764445
Genome map
AA seq 427 aa AA seqDB search
MSQSETLYSQAKHVIPGGVNSPVRAFNGVGGTPVFIHRADGAYLYDVDNNAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTAAEVEMAKLVTKLVPSMDMVRMVNSGTEATM
SAIRLARGYTRRDKIIKFEGCYHGHADCLLVKAGSGALTMGQPNSPGVPADFAKHTLTCV
YNDLNSVREAFEKYPEEIACIIVEPVAGNMNCIPPLPEFLPGLRKLCDEFGTLLIIDEVM
TGFRVALGGAQEYYDVKPDLTSLGKIIGGGMPVGAFGGRLEIMEKLAPTGPVYQAGTLSG
NPIAMAAGLACLHEVAQAGVHLRLSELTDNLASGLKNAASKAGIPLVVNHVGGMFGIFFT
DAESVTCYQDAMQCDVERFKQFFHLMLEERVYLAPSAFEAGFMSIAHTDEDIQRTVDAAA
RSFAKLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtccgaaacgctttattctcaggcgaaacatgtgatccccggcggtgtcaat
tcacctgtacgtgcttttaatggtgttggcggtacgcctgtctttatccatcgtgccgat
ggtgcttatctgtatgacgttgataacaatgcctatatcgattatgtcggttcatggggg
ccgatggtgcttggacataaccatccggctatccgcaatgcggtgattgaagcggctgag
cgtggcctgagttttggcgcacccactgctgctgaagtagaaatggcaaaactcgtcacc
aaacttgtgccttccatggatatggttcgcatggtgaattcaggtacagaagcgaccatg
agcgctattcgtctggcccgcggttatacccggcgcgacaaaatcattaaatttgaaggc
tgctaccacggtcatgctgattgtctgctggtcaaagccggttctggtgctttgaccatg
ggtcagcctaactcaccgggtgttcctgcggattttgccaagcataccctgacttgtgtt
tacaatgacctgaattcagtccgtgaagccttcgaaaaatacccggaagagatcgcctgt
attatcgtcgaaccggtcgcgggtaatatgaactgcattccgccactgccagagttcctg
ccgggtctgcgtaaactgtgtgatgaatttggtactctgctgatcattgatgaagtgatg
acgggtttccgtgtcgcgctgggcggggcacaagaatattacgatgttaaaccggatctg
acctcccttggcaaaatcatcggcggcggtatgcctgtcggtgcttttggtggccgtctg
gaaatcatggaaaaactggcaccaaccggcccggtttatcaggctggtacgctttctggt
aacccgattgctatggctgcgggtctggcgtgtctgcacgaagtggctcaggctggcgtt
cacctgcgtttgagtgaattgactgacaatctggcttcaggtttgaaaaacgcggcatca
aaagcgggcattccgttggttgttaatcacgttggaggcatgttcgggattttctttact
gatgcagaaagtgtgacctgctatcaggatgccatgcagtgtgatgtagagcgcttcaaa
cagttcttccacctgatgctggaagagagggtttatctggctccttctgcgtttgaagca
ggctttatgtctatcgcccatactgatgaagatatccagcgtacggttgatgcagcagca
cgcagtttcgctaaactgaaataa

DBGET integrated database retrieval system