KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0896Help
Entry
XNC1_0896         CDS       T01274                                 

Gene name
yadB
Definition
(GenBank) putative glutamyl t-RNA synthetase with nucleotidylyl transferase domain
  KO
K01894  glutamyl-Q tRNA(Asp) synthetase [EC:6.1.1.-]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xne01007]
    XNC1_0896 (yadB)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_0896 (yadB)
Enzymes [BR:xne01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.-  
     XNC1_0896 (yadB)
Amino acid related enzymes [BR:xne01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   XNC1_0896 (yadB)
Transfer RNA biogenesis [BR:xne03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    XNC1_0896 (yadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: CBJ88967
UniProt: D3VL08
Position
771121..772014
Genome map
AA seq 297 aa AA seqDB search
MTQSEHSSLYIGRFAPSPSGDLHFGSLVTALGSYLQARACRGKWLMRIDDIDPPREIAGA
AGRILKSLEHYGLYWDGEVLYQSQRHEAYRTILEQLKQQEKSYSCTCTRQRIQQLGGFYD
GYCQYLYPPANHAAIRLKQHYPVYGFHDKLQGYITVHKAMAEEDFIIHRKDGFFAYNLVV
VIDDNYQGVTEIVRGADLIEPTVRQLSLYQHLNFKMPDYVHLPLVLNTEGNKLSKQNHAQ
PIHLGDPRPLLINALSFLNQPAIAGWQDLTTEQLLGHAIAGWNINTVPPEKHNPSPI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatcagaacattcttcgttatatatcgggcggttcgccccatcaccttccggc
gatcttcattttggttccctggtcactgctctgggcagttatctgcaagcccgcgcctgc
cgcggaaaatggctgatgcgtattgatgatatcgaccctccgagggaaattgccggagct
gccggccggatactgaaatcccttgagcattatggcctttactgggatggagaggttctt
tatcaatcccaacgtcatgaagcctaccgtactatccttgaacaattaaaacagcaggaa
aaaagctatagctgtacctgtacccgccagcgtattcaacaactgggcggtttttatgat
ggttactgccaatatttgtacccccccgcaaaccatgccgcaatccgtctgaagcagcac
tatccggtttacggttttcacgataaattacagggttacatcaccgtccacaaagcaatg
gcggaagaagatttcatcattcatcgcaaagacggtttcttcgcctataatcttgtcgtt
gttattgatgataactatcagggtgttactgaaattgtcagaggggctgatttaattgaa
ccgaccgttcgccagctatctctgtatcagcatttgaattttaagatgccggattatgtg
catttgcctctcgtactcaatacagagggaaataaactctctaagcaaaatcacgcccaa
cctattcatttgggtgatccaagacccttgcttattaatgcgttatcattcttaaatcaa
cccgctattgcaggctggcaggatctcaccacagagcaattgctggggcacgctatcgct
ggttggaatataaataccgttccgcctgaaaaacataacccatcgccaatttaa

DBGET integrated database retrieval system