KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0901Help
Entry
XNC1_0901         CDS       T01274                                 

Gene name
panC
Definition
(GenBank) pantothenate synthetase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00410  beta-Alanine metabolism
xne00770  Pantothenate and CoA biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XNC1_0901 (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    XNC1_0901 (panC)
Enzymes [BR:xne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     XNC1_0901 (panC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: CBJ88972
UniProt: D3VL13
Position
775016..775873
Genome map
AA seq 285 aa AA seqDB search
MLIIETIPLLRREIRRWHQAGKRIAFVPTMGNLHDGHLALVDTAKAQADVVIVSIFVNPM
QFDREDDLANYPRTLQEDCERLNHRNVELVFAPNAHEIYPNGLNGNQTFIEVPELSHILE
GTSRPGHFRGVTTVVSKLFNLIQPDLVYFGEKDFQQLQIIRKMIADMAYDITLVSVPTVR
DKNGLALSSRNNLLSTEEKKIAPLLSKVMQVIAERLQHGERETEKLIELASAHLRKEGFM
PDELFIRDAENLLPLTTQSKRAVILMAAWLGQTRLIDNQQVDLTN
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcatagaaactatccctcttttgcgccgtgaaatccgccgttggcatcaggca
ggtaaacgcatagcctttgttcctacaatgggcaatctgcatgatggccacctggcatta
gttgataccgctaaagcacaggccgatgtcgttattgtcagtatttttgtcaacccgatg
caatttgaccgggaagatgacctggccaattacccacgaaccttacaagaagattgcgaa
aggctgaaccatcgcaatgttgaactggtttttgcgcctaatgcccatgagatatacccg
aatggcttaaacggcaatcaaacttttatcgaagtgccagagctttctcatatactcgaa
ggcaccagccgtccggggcatttccggggtgtcactaccgttgtcagtaaattgtttaat
ctgatccaacctgatcttgtctattttggtgaaaaagattttcagcaattacagattatt
cgcaaaatgattgcagatatggcttacgatattacgttagtttctgtgcctaccgtccga
gataagaacggattggcattaagttcacgtaataatctcttatccacagaggagaaaaaa
attgcacctttactcagtaaagtgatgcaggttatcgcggaacgattgcaacatggagaa
agggagacagaaaaattaattgaactggcatctgcacacctacggaaagaaggttttatg
ccggatgagttatttatccgcgatgcagaaaatctgttacccctgacaacacaaagtaaa
agagccgtgatcctaatggctgcatggttagggcaaacgcgcctgattgataatcagcag
gttgatttaaccaactga

DBGET integrated database retrieval system