KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0922Help
Entry
XNC1_0922         CDS       T01274                                 

Gene name
purE
Definition
(GenBank) phosphoribosylaminoimidazole carboxylase = AIR carboxylase, catalytic subunit
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00230  Purine metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01130  Biosynthesis of antibiotics
Module
xne_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XNC1_0922 (purE)
Enzymes [BR:xne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     XNC1_0922 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC
Motif
Other DBs
NCBI-ProteinID: CBJ88993
UniProt: D3VL34
Position
789481..790047
Genome map
AA seq 188 aa AA seqDB search
MTASSDPSKAISTAAISPTTISAQKHAKIAIVMGSKSDWTTMQHAADILTALAIPFHVEI
VSAHRTPDKLFYFAEQAKQNGFDVIIAGAGGAAHLPGMLAAKTLVPVFGVPVQSAALSGV
DSLYSIVQMPKGIPVGTLAIGKAGAANAALLAAQVLALHDDKVFQRLSYWRQAQTQDVLD
NPDPRENV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgacggccagctctgatccttcaaaagcgatttccacagcagccatttcccctacaaca
atatcagcgcagaaacacgccaaaatcgccattgtcatgggctcaaaaagcgactggaca
acaatgcaacatgcggccgatatcttgaccgcgctggcgatcccttttcacgttgaaatt
gtgtcggcacaccggacacccgataaacttttttattttgctgagcaagctaaacaaaac
ggttttgatgtcattatcgcgggtgccggtggtgcagcacatttacccggaatgctggct
gccaaaaccttagtgcctgtgtttggtgttcctgtacaaagcgctgcactcagtggtgtt
gatagcttatattcaattgtccaaatgccaaaaggtattccggtgggtacgctggccatt
ggcaaggcaggagccgcaaatgcagcactgctggcggcacaggtactggctttgcatgat
gataaggtattccagcgtctgtcatattggcgccaagcacaaacacaggatgtcttggat
aatcctgacccacgggagaatgtatga

DBGET integrated database retrieval system