KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0937Help
Entry
XNC1_0937         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03976  Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase [EC:3.1.1.-]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_0937
Enzymes [BR:xne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     XNC1_0937
Transfer RNA biogenesis [BR:xne03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    XNC1_0937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_edit TFIIS_M
Motif
Other DBs
NCBI-ProteinID: CBJ89008
UniProt: D3VL49
Position
805020..805340
Genome map
AA seq 106 aa AA seqDB search
MTPAIVLLEKQKIDFKLHPYEHDANEHNFGDEVVKKLGLDAKQVFKTLLISLNGDPKNLA
VAVTPVSGQLDLKKIAKVFKAKKADMADPQLAQKVTGYLVGGIRGC
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgactcccgcaattgtcttgctggaaaagcaaaaaattgatttcaaactccatccttat
gaacatgatgccaatgaacataactttggtgatgaagtagttaaaaagcttggtttagat
gccaagcaggtttttaaaacgctgctgatttcactgaatggcgatcccaaaaatcttgca
gttgctgtcactccagtctctggacaactcgatttgaagaaaattgccaaagtcttcaag
gccaagaaagcggatatggctgaccctcagttagcacaaaaagttacgggttatttagtc
ggcggtattaggggctgttga

DBGET integrated database retrieval system