KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0973Help
Entry
XNC1_0973         CDS       T01274                                 

Definition
(GenBank) putative Cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00270  Cysteine and methionine metabolism
xne00920  Sulfur metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01200  Carbon metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XNC1_0973
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XNC1_0973
Enzymes [BR:xne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     XNC1_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBJ89044
UniProt: D3VL85
Position
843033..844085
Genome map
AA seq 350 aa AA seqDB search
MSSLWAKNAIRAIQADYQRSADTHLIRLNLPMFPDIHLYLKDESTHPTGSLKHRLARSLF
LYALTNGWIKEGTPIIEASSGSTAVSEAYFARLLGLPFIAVMPSCTAKRKVQEIEFHGGQ
CHFVEHSALIYQESERLAKELNGHYMDQFTYAERATDWRGNNNIAESIFRHMKLEPFPEP
TYIVMSAGTGGTSATLGRYIRYQGYDTKLIVVDPENSVFYDCYRQNCREIRSDTGSKIEG
IGRPRVEPSFISTVVDDMFQVPDAASIATIYWLEKLIGRKTGASTGTNVWGALQLAKQMR
DNNQQGAIVTLICDSGERYLDTYYNPEWIRNNIGDVTQYLTQLPKLNGYK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctttatgggctaaaaatgccataagagctatccaggctgattatcaacgcagt
gctgatactcatctgattcgcctcaaccttcccatgtttccagatattcacctctatctt
aaagatgaaagtacgcatcctacaggtagtctgaaacatagacttgcacgctccttattc
ctttatgcactgacgaatggctggattaaggaaggaacgccaattattgaagcatcatcc
ggtagtaccgctgtttcagaagcttattttgcccgcttgcttgggttgccctttattgct
gtaatgccctcctgcaccgctaaacgcaaagttcaggaaattgagttccacggtggtcaa
tgccattttgtagaacattctgccctgatttatcaagaatcagaacggctggccaaagag
ctgaatggccattacatggatcagttcacctatgctgaacgagcaactgattggcgagga
aacaacaatattgcagagagtatttttcgccatatgaaactggaaccttttcctgaacca
acttatatcgttatgagtgcaggaactgggggtacatcagcaacgcttggccgctatatc
cgttatcagggatatgataccaagctgattgttgtcgatcctgaaaactccgttttttac
gattgttatcgtcagaactgccgagaaattcgcagtgatactggcagtaaaatcgaaggt
attggtcgtccacgtgtagaaccctcctttatctccacagttgtcgatgacatgttccaa
gttcctgacgctgcttctattgctactatttattggcttgaaaaattaattggtagaaaa
acaggtgcatcaacaggaaccaacgtctggggtgctttgcaactcgccaaacaaatgcgc
gataacaaccaacagggtgcaatcgtgacattaatatgtgatagcggggaacgctatctt
gatacttattacaatccggaatggatccgcaataatatcggtgatgtcacacagtattta
acacaactacccaaattaaacggttataagtaa

KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1083Help
Entry
XNC1_1083         CDS       T01274                                 

Definition
(GenBank) putative Cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00270  Cysteine and methionine metabolism
xne00920  Sulfur metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01200  Carbon metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XNC1_1083
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XNC1_1083
Enzymes [BR:xne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     XNC1_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBJ89154
UniProt: D3V8V6
Position
complement(962852..963868)
Genome map
AA seq 338 aa AA seqDB search
MNFELFNSQDSMPDTEKAFTLFPELKKIDNTLGNTTLIPVPSPEGKASILAKLEFENPFG
SVKDRVAFGLFCDAINQHDFSQGELKLLDASGGNMAKALAKLGNMCDIPVHVVVPDSAPE
ELIDIFKTENATITCVDHNFFLLGVITRARQIAEEDSSWTLLAQHLNRVNTAIHEYQTGT
EIREQLNGTYADGWVAAVGTGGTLAGVATALRRDNPQLKVWGTTTKELPYGSLAAPNGKK
KFAGAGGFGWGFRQPFINQLMPEEPYFNQVSYREAISAMYEFFQLTGMKIGSSSAANWKT
AWKLAETMTPDQQIVTLFADAGSDADRELGREWFNQPS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaactatttaattcacaagatagtatgccagatacagaaaaagcctttact
ctgtttcccgaactgaaaaaaattgataatacattggggaataccactttgattcctgtt
ccctcaccagaagggaaagcatcaattcttgctaaactcgaatttgaaaacccatttggc
tcagtgaaagaccgggtggcttttggcttattctgtgacgccatcaaccaacatgatttt
tcccaaggagagttaaagttacttgacgcctctggtggcaacatggcaaaagcactggca
aaactgggtaatatgtgtgacatccctgtacatgttgtcgttcctgattccgcaccagag
gaactcattgacatattcaaaacagaaaacgctaccatcacttgtgtagatcacaacttt
ttccttctcggtgttatcactcgtgctcgacaaattgcagaagaagatagtagctggacg
ttactcgcccaacatctcaatagagtgaacacggccattcatgaataccagaccggcacc
gaaattcgcgagcaattgaatggtacttatgccgatggctgggttgcggcggtgggaaca
ggtggcactttagctggtgtggctacagccttgcgtcgagataatcctcaactgaaagtg
tgggggacgacaacgaaagaattgccttacggttcactggctgcgcctaacggtaaaaaa
aagtttgcgggtgctggtggatttggctggggtttccgtcaaccttttattaatcaactc
atgcctgaagaaccatattttaatcaagtgtcctacagagaagccatcagcgcaatgtat
gaatttttccaattaacgggaatgaaaattggctcttcatcggcagcaaactggaaaacc
gcgtggaaacttgctgaaacgatgacacctgatcagcaaattgtgacactgtttgctgat
gccggaagcgatgcagacagagaactgggtcgcgagtggtttaaccaacccagctaa

KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3211Help
Entry
XNC1_3211         CDS       T01274                                 

Gene name
cysK
Definition
(GenBank) subunit of cysteine synthase A and O-acetylserine sulfhydrolase A, PLP-dependent enzyme
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00270  Cysteine and methionine metabolism
xne00920  Sulfur metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01200  Carbon metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XNC1_3211 (cysK)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XNC1_3211 (cysK)
Enzymes [BR:xne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     XNC1_3211 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP PRMT5 Pribosyltran
Motif
Other DBs
NCBI-ProteinID: CBJ91263
UniProt: D3VLD7
Position
3156943..3157896
Genome map
AA seq 317 aa AA seqDB search
MSKIYEDNSLTIGHTPLVRLKNFANGRILAKIESRNPSFSVKCRIGANMIWDAEKRGILT
KDKELIEPTSGNTGIALAYVAAARGYKLTLTMPETMSLERRKLLKALGANLVLTEGPKGM
KGAIEKANEIHDSNPDRYVLLQQFSNPANPEIHEKTTGPEIWEDTDGEVDVFVAGVGTGG
TITGVARYLKNTRGKQVTIVAVEPEDSPVISQKLAGEELKPGSHKIQGIGAGFIPDNLDL
TLVDRVFKISNEEAIQTAREVTEKEGILSGISSGAAVAAAVRLSQEDEYKDKNIVVILPS
SAERYLSTVLFADLQND
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatttatgaagataattcattgactattggtcacactccgctggtacgctta
aaaaactttgccaatggccgtattttggcaaagatagaatcacgtaaccccagcttcagt
gtaaaatgccgcattggtgccaatatgatctgggatgctgaaaaacgcggtattctcacc
aaagataaagaactcatcgaaccgaccagtggtaatacaggaattgcgcttgcttatgtc
gctgctgcccgtggctataagctgacgttaaccatgcctgaaaccatgagtcttgagcgc
cgcaagctactgaaagcactgggggctaatttggtcttgacagaaggccctaaaggtatg
aaaggagccatcgaaaaagccaacgaaattcatgatagcaaccctgaccgttatgtactc
ctgcaacaattcagcaacccagccaacccggaaattcacgaaaaaaccacaggtcccgaa
atttgggaagatactgacggtgaagttgatgttttcgtggcgggtgtaggtactggcggt
acaatcaccggtgttgcccgttacctgaaaaatactcgcggcaagcaagttaccatcgtt
gctgtagaaccagaagattcaccagtgatcagccagaaattagccggcgaagagcttaaa
ccaggctcacataaaattcagggaattggcgctggtttcatccctgataacttagattta
acattagttgaccgtgtctttaaaatcagtaacgaagaagcgattcaaacagcaagagaa
gttactgaaaaagaaggaattctttccggtatttcttctggtgcggctgttgctgcagca
gtcagattatcgcaggaagatgaatataaagacaaaaacatcgtggtgattctgccttct
tctgctgaacgttatctcagcacagtattgtttgctgatttgcagaatgattaa

DBGET integrated database retrieval system