KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0974Help
Entry
XNC1_0974         CDS       T01274                                 

Gene name
ybaX
Definition
(GenBank) putative (aluminum) resistance protein with adenine nucleotide alpha hydrolase domain
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00790  Folate biosynthesis
xne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XNC1_0974 (ybaX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_0974 (ybaX)
Enzymes [BR:xne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     XNC1_0974 (ybaX)
Transfer RNA biogenesis [BR:xne03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    XNC1_0974 (ybaX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueC Arginosuc_synth Asn_synthase PAPS_reduct ATP_bind_3 Diphthami_syn_2 ThiI
Motif
Other DBs
NCBI-ProteinID: CBJ89045
UniProt: D3VL86
Position
844117..844815
Genome map
AA seq 232 aa AA seqDB search
MKRAVVVFSGGQDSTTCLIQALRQYDEVHCVTFDYGQRHRAEIDVASRISKELGAAAHKV
LDVTLLNELAISSLTRDNIPVPDFNASEKSDLPNTFVPGRNILFLTLAAIYAYQVEAEAV
ITGVCETDFSGYPDCRDEFVRALNKAVSLGIARDIRFETPLMWLNKAETWALADYYKKLD
FIRNQTLTCYNGIQGDGCSECAACHLRAKGLTNYLDNSQSIMAEMKSKTHLS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagccgttgttgtattcagtggtgggcaggactccaccacttgtttgattcaa
gcccttcgtcaatatgacgaagttcattgtgttacttttgactatggacagcggcatcgt
gctgaaattgacgtcgcttctcgcatcagcaaagaattgggagcggctgcccacaaagta
cttgatgttactttgttaaatgaactagcaatcagtagcctaacaagagacaacattcct
gtacccgatttcaatgcaagtgaaaaaagcgacctcccaaatacttttgtgcccggccgt
aatattttatttttaactctggccgctatttatgcttatcaggttgaagctgaagccgtg
attactggtgtttgtgaaactgatttttcaggttatccagattgtcgtgacgaatttgtc
agagcactgaataaagctgtcagtcttggtatcgctcgtgatatccgttttgaaacaccg
ctaatgtggctgaacaaagcagaaacttgggcactggccgattactataaaaaattagat
tttattcgtaaccagaccctgacttgttataatggcattcagggtgatggatgcagtgaa
tgtgctgcctgccacctccgagccaagggattaactaattatttggataattcccaatct
ataatggcagagatgaaatctaaaacacatttaagttag

DBGET integrated database retrieval system