KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0997Help
Entry
XNC1_0997         CDS       T01274                                 

Gene name
panE
Definition
(GenBank) 2-dehydropantoate reductase, NADPH-specific, alternative pyrimidine biosynthesis
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00770  Pantothenate and CoA biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    XNC1_0997 (panE)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     XNC1_0997 (panE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ApbA_C ApbA F420_oxidored NAD_Gly3P_dh_N DDE_Tnp_IS66
Motif
Other DBs
NCBI-ProteinID: CBJ89068
UniProt: D3VLA9
Position
867328..868248
Genome map
AA seq 306 aa AA seqDB search
MKITILGCGAIGKLWLAALSRQDHNIQGWLRVPQPAVSVQIENLNGKGEIFNQQFPANDV
KHLAESELLLVCLKAWQVSDAINHLATKLSPHCPILLLHNGMGSQEEFLPLPNPILLGVT
THGAYQKNGIVYHKSQGMTHIGSVTKNANQLSRLADILHCALPDVAWHNEIYTISWMKLA
VNCVINPLTAIYECRNGDLQHHQSHIQLLCDEIHRVMEHDGIHTSRQTLIDYVMNVIEQT
SENYSSMLQDIRAQRHTEIDYITGFLLRRARIHGLTITENLIIYQNIKRKEEEYEHISPH
FSGSRQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaccattcttggctgtggtgctataggcaaattgtggcttgctgctttgtcc
cggcaggatcataacattcagggatggctaagagttccacaacctgctgtttccgtccag
attgagaatttaaatggcaagggagaaatatttaatcagcagtttccagccaatgacgta
aaacatctcgccgaaagcgaattacttctcgtttgtttaaaagcctggcaagtttctgac
gcgattaatcaccttgcaaccaaactttctcctcattgtccgatcctgttattacataat
ggaatgggttcacaagaagagttcctgcctttacccaatcccattttacttggcgtgacg
actcatggtgcttatcagaaaaatggcattgtttatcacaagtcacaaggcatgactcat
atcggttccgtgacaaagaatgccaatcagctcagcagattggctgatattctgcattgc
gctctacccgatgtagcatggcataatgaaatatacaccatcagttggatgaagctggcg
gttaactgtgtcattaacccactcacagcaatatatgaatgcagaaacggtgatttacag
catcatcagtcacatatccaattattgtgtgacgaaattcaccgggtcatggaacatgat
ggtatccatacatccagacagacacttattgattacgtcatgaatgtcattgagcaaaca
tcggaaaattactcatcaatgctgcaagatatacgcgcacagcggcatacagaaatagac
tacatcaccggctttttactgcgccgggcgcgtatacacgggcttacaatcactgaaaac
ctcattatttatcagaatattaaacgcaaggaggaagaatatgagcatatcagccctcat
ttttctggctcacggcagtga

KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2159Help
Entry
XNC1_2159         CDS       T01274                                 

Definition
(GenBank) putative 2-dehydropantoate 2-reductase
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00770  Pantothenate and CoA biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    XNC1_2159
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     XNC1_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ApbA_C ApbA Staph_opine_DH F420_oxidored NAD_binding_8 NAD_binding_7 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBJ90218
UniProt: D3VEV6
Position
2077362..2078366
Genome map
AA seq 334 aa AA seqDB search
MLRIGIIGTGAVACYLAHQCKKQGCQVFLLSSRGIRNQSHPIHQIQLSDDTNHGQAAGED
FGSVIIDGHFTDYADFLAKDFDQLYVCSKTVSNRYICQQLSRYKHLLHSPVVIFQNGFAT
EQPFIDEMLGVTVIRGVLNFSVTLQGEQNLRLMFLKTSYLGCVEQTKWAETDISAVLDLL
NQVEIPFECCGDIAHKAFAKNTLNAAASVCGLIRIGVQTAMRNISSRSVIQSIIDECTAI
GEKTGYVKDSEHFRRQSTGYLLSIPDFDSSLVLDVINGRETEADTLLASFIELSQHVDIA
TPSLDFVYRYFDFYNTYITQSQAFTKIILVEGEA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttaggataggcattatcggtacaggcgccgttgcgtgttatttggcgcatcaatgt
aaaaaacaagggtgtcaggttttcttattatcttcgcggggtataagaaaccagtcacat
cctatccatcaaatacaactcagtgatgatacgaatcatggtcaggctgcgggtgaagat
ttcggcagtgttattatcgatggtcattttaccgactatgccgattttctcgctaaagac
ttcgatcaattgtatgtatgcagtaaaacggtttccaaccgatatatttgtcagcagttg
tcgcgctataaacatctgctgcatagccctgtagttatctttcagaacggatttgccaca
gagcagccatttattgatgaaatgttaggtgtcacggtgatccgtggtgtgcttaatttt
tcagtgacgctacagggtgaacaaaacctgagattgatgttcctgaaaaccagctatctt
ggatgcgttgaacagaccaaatgggccgaaacagatatttcggctgttctggatttactc
aatcaggtcgagatcccttttgaatgctgcggggatatcgcacataaagcctttgcaaaa
aatacacttaatgcagcggcgtcagtatgtgggctaatccgcatcggtgtacaaacagca
atgcgcaatataagttcccgatccgtcattcaatcgatcattgatgaatgtactgccatt
ggtgagaaaacgggatatgttaaagacagtgaacattttcggcgtcaatccacagggtat
ttgttgtcaattcctgattttgactcctctctggtgctggatgtcatcaatggcagagag
acagaagccgatactttacttgcctcttttatcgagctgagtcaacacgttgatattgcc
acgccatctctggattttgtttatcgctatttcgatttttacaacacatatataacccaa
tctcaggcattcacgaagattattttggttgaaggagaagcttaa

DBGET integrated database retrieval system