KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1041Help
Entry
XNC1_1041         CDS       T01274                                 

Gene name
leuA
Definition
(GenBank) 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00290  Valine, leucine and isoleucine biosynthesis
xne00620  Pyruvate metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01210  2-Oxocarboxylic acid metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XNC1_1041 (leuA)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    XNC1_1041 (leuA)
Enzymes [BR:xne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     XNC1_1041 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer
Motif
Other DBs
NCBI-ProteinID: CBJ89112
UniProt: D3V8R4
Position
complement(914099..915718)
Genome map
AA seq 539 aa AA seqDB search
MSQQVIIFDTTLRDGEQALQASLSVKEKLQIAYALERLGVDIIEAGFPVSSPGDFQSVQT
IAREIKNSRICALSRCVDNDIDVAAEALRVAEAFRLHMVLATSNLHVEHKLKRTFDDVVE
MAVRSIKRARNYTDDIEFSCEDAGRTSIDNLCRIVEQAIKAGATTVNIPDTVGYTTPYQF
GGIISTLFDRVPNIDKAIISVHCHDDLGMSVANSITAVQAGARQIEGTINGLGERAGNCS
LEEAIMTIKTRQQMLGVHTNINHQEIYRTSQLVSQICNTPIPAHKAVVGSNAFAHSSGIH
QDGVLKNRETYEIMTPESIGLKDTQLNLTSRSGRAAVKHRMTEMGYQENDYDLDILYQAF
LKLADKKGQVFDYDLEALVFINQQQQEYEHYRLDYFSIQSGTNVVPTATVRLACGDEITS
EAATGNGTVDAIYQAIGRITGYPLKLISYQLSGKGHGKDALGQVDIIVECFGRRFHGMGL
ETDIIESSARAMIHVLNNIWQAEQVEKEKQRISHCNTQGNTPNDIQGNTDSHGNTKETA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcaagttattatcttcgataccacactgcgtgatggagaacaggcattacag
gctagtttgagcgtaaaagagaaactgcaaatcgcttatgcgttggaaaggttgggagtt
gatatcattgaagcgggctttccggtttcctcccccggtgattttcaatcagttcagacc
attgcccgtgaaattaaaaatagccgtatttgtgctttatcccgttgtgttgacaatgat
attgatgttgccgctgaagctttgagagtcgccgaagcctttcgtttgcatatggtactg
gctacctccaatctgcatgtcgaacataaattaaaaagaacgtttgatgatgttgttgaa
atggctgttcgttccatcaagcgagcgcgtaattatactgacgacatcgagttttcctgt
gaagatgcaggtcgcacaagcatcgacaatttatgcagaattgtcgaacaggcaataaag
gcgggtgcaactacggtcaatattcccgataccgtgggttatacaacaccttatcaattc
ggcgggattatcagtactttatttgaccgtgtaccgaatattgataaagcgattatttcc
gttcattgccatgacgatctgggcatgtccgtggctaactcaattaccgcagttcaggca
ggagccagacagattgaaggtactatcaatggattaggcgaacgtgcgggtaactgttca
ctggaagaagcgatcatgactatcaaaacccgccaacaaatgttgggggttcataccaat
attaaccaccaagaaatctaccgtaccagccaattagttagccagatttgcaatacgcct
atccctgcccataaagcggttgttggcagtaatgcgtttgcccactcttccggtattcat
caggatggcgttctgaaaaatcgtgaaacttacgaaatcatgacacctgagtccatcggc
ctgaaagatacacagttaaacctgacttcgcgttccggacgcgctgccgtgaaacaccgc
atgaccgagatgggttatcaggaaaatgattatgatctagatatcttgtatcaagcgttc
ttaaagctggcagacaaaaaagggcaagtatttgattacgacttggaagcattagtgttc
atcaatcaacaacagcaagaatatgagcattatcgtcttgattatttcagcatccagtcc
ggtaccaatgtcgtaccgacagcaacggtacgtttagcctgcggtgatgaaatcacgtct
gaagccgcgacgggaaatggtacagttgatgccatttatcaagctatcggccgcattaca
ggttatccgcttaaattaatctcctatcaattatccggcaaaggacatggtaaagatgct
ctcggtcaggttgatatcattgtggaatgttttggccgtcgtttccacggcatgggatta
gaaacagacatcatcgaatcttccgccagagctatgattcacgtcttgaataatatttgg
caagcagaacaagtcgaaaaagaaaagcagcgtatatcccactgcaatacccaaggtaac
acgccaaacgatattcagggcaacactgactctcacggtaacacaaaggaaactgcataa

DBGET integrated database retrieval system