KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1081Help
Entry
XNC1_1081         CDS       T01274                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoyltransacetylase subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00010  Glycolysis / Gluconeogenesis
xne00020  Citrate cycle (TCA cycle)
xne00620  Pyruvate metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
Module
xne_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_1081 (aceF)
   00020 Citrate cycle (TCA cycle)
    XNC1_1081 (aceF)
   00620 Pyruvate metabolism
    XNC1_1081 (aceF)
Enzymes [BR:xne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XNC1_1081 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: CBJ89152
UniProt: D3V8V4
Position
959547..961106
Genome map
AA seq 519 aa AA seqDB search
MSIEINVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDKVETGKLIMVFESANGAAEAVALAAAPAAAESKEVNVPDIGGDEVEVTEIMVKVGDT
ITEEQSLITVEGDKASMEVPAPFAGTVKEIKIAAGDKVKTGSLIMVFEVTGAAPAVALAA
APAVASAPAIASEKAAPAASQPAEGKNEFAENDAYIHATPVIRRLAREFGVNLAKVKGTG
RKGRILREDVQAYVKDAIKRAEAAPAAAGGGLPGMLPWPKVDFSKFGEIEEVEMSRIQKI
SGANLSRNWVMIPHVNLFDEADITEVEEFRKQQNKEVEKKQLDVKITPLVFVMKAAAKAL
EAMPRFNSSISEDGQKLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIVELSRELAEVSK
KARAGKLTASDMQGGCFTISSLGGIGTTGFAPIVNAPEVAIMGLSRSSMKPVWNGKEFVP
RLILPMSLSFDHRVIDGADGARFITYINQLMSDMRRLVM
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaaattaacgtacctgatattggtgcagatgaagttgaagttaccgaaatc
atggtaaaagtgggtgacactgtagaagcagaacagtcactgatcacggttgaaggtgac
aaggcttccatggaagtcccatctcctcaggctggtgtggttaaagagatcaaaattgcg
gttggcgataaagttgaaaccggcaaacttatcatggtttttgaatccgcaaacggtgca
gcagaagctgttgctcttgcggcagctccagcagcggctgaaagcaaagaagttaatgta
ccggatatcggtggtgacgaagttgaagttaccgaaatcatggtaaaggtcggtgatacc
atcactgaagagcagtctttgatcacggttgaaggtgacaaggcttctatggaagtgcct
gcgccattcgcgggtactgtgaaagagatcaaaatcgcggctggcgacaaagtcaaaacc
ggctctctgatcatggtatttgaagttacgggcgcagcaccggcggtagcgctggcagcg
gctcctgcggtagcatctgctcctgcgatagcatctgagaaagcagcgcctgccgcaagc
cagccagcagaaggtaaaaacgaattcgcggaaaatgacgcttacattcatgcaactccg
gtaatccgtcgtctggctcgtgagtttggtgtaaacctggctaaagtcaaaggcacgggt
cgtaaaggccgtatcctgcgtgaagacgttcaggcttacgtgaaagatgcgatcaaacgt
gcggaagcagcacctgctgctgcgggcggtggtctgccgggtatgctgccttggccaaaa
gttgatttcagcaaatttggtgaaatcgaagaagttgaaatgagtcgtatccagaaaatc
tccggggcgaacctgagccgtaactgggtcatgatccctcatgttaatttgttcgacgaa
gcggatatcactgaagttgaagaattccgtaaacagcagaacaaagaagttgagaagaaa
cagctggatgtgaagatcactccgctggtattcgtcatgaaagcggctgcgaaagcactg
gaagccatgcctcgcttcaacagctccatctctgaagatggccagaagctgatcctgaaa
aaatacgttaacatcggtatcgcggttgatacgcctaatggtctggttgttcctgtattc
aaggacgtcaacaagaaaggcatcgtggaattgtccagagaactggctgaagtttccaag
aaagcacgtgccggtaagttgactgcttctgacatgcagggtggttgtttcaccatttcc
agcctgggtggtatcggtactaccggttttgcaccaattgtgaatgcgccagaagtggca
atcatgggtctgtctcgttcttccatgaaacccgtctggaatggcaaggaattcgttcct
cgtctgattctgccaatgtccctgtctttcgaccaccgtgtgattgacggagcagatggt
gcgcgcttcatcacttatattaatcagttgatgagcgacatgcgccgtttggtgatgtaa

DBGET integrated database retrieval system