KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1132
Entry
XNC1_1132         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein; putative exported protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB
Motif
Pfam: DUF4354 DUF4352 LTD
Other DBs
NCBI-ProteinID: CBJ89203
UniProt: D3V905
Position
1009249..1009629
AA seq 126 aa
MKVSTFVASIALAGFCFVANASTLDRVAVYSTEKSNGSVSVGGKNAYTKSFEVAVANLSD
KDIDLSKLCLKAYSPDKKEFRLDTVDEDLNQGTLKAGKSVRGIAVLASENDVVHKAALIK
ISADCK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaaggtttccacatttgttgcatcaattgctttggctggcttttgctttgttgcaaac
gcttctactcttgatagggttgctgtttattctacggagaaatctaacggctctgtgtca
gtgggtggcaaaaatgcttacactaaatcctttgaagttgcagtagcgaacttatccgat
aaggatattgatttgtccaagctttgtctgaaagcttactctcctgacaaaaaagaattt
aggctggatacggttgatgaagacctgaatcagggcacgctgaaagcgggcaagtccgtc
agaggtattgctgtgcttgcttctgaaaatgacgtagttcataaagccgctcttattaaa
atttctgccgattgcaagtaa

DBGET integrated database retrieval system