KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1153Help
Entry
XNC1_1153         CDS       T01274                                 

Definition
(GenBank) putative cobalt-precorrin-6Y C(5)-methyltransferase (Cobalt-precorrin-6 methyltransferase) (Cobalt-precorrin-6Y methylase)
  KO
K03399  cobalt-precorrin-7 (C5)-methyltransferase [EC:2.1.1.289]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00860  Porphyrin and chlorophyll metabolism
xne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNC1_1153
Enzymes [BR:xne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.289  cobalt-precorrin-7 (C5)-methyltransferase
     XNC1_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Radical_SAM_N
Motif
Other DBs
NCBI-ProteinID: CBJ89224
UniProt: D3V926
Position
1030137..1030766
Genome map
AA seq 209 aa AA seqDB search
MITVVGIGPGAAAHQTLAALDAIKQAEILVGGARHLAEFPHFCGETRRINADMDGLMMWL
EQNQHRQIVVLASGDPLFYGIGKRIAAHFAERQTDKQNVRIISGISAIQYLCARILLDMN
DIYLTSSHGRKPDFDWLLRHEKIAMVTDDVIGPYQIAQEILAHGQPRRMVIGENLSQENE
RIVCLNAEQIAQRGDIHYDLNVVVILNER
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgttgttggcattggccccggagctgcagcacaccaaacactggctgcattg
gatgcgataaaacaggcggaaattttggtcggcggagcacgtcatcttgctgagttcccg
catttctgtggtgaaacccgtcggataaatgccgatatggatgggttaatgatgtggctc
gaacagaatcaacatcggcaaatcgtggtactcgcttcgggtgaccctctcttttatggc
attggtaaacgaattgcggcgcattttgccgaacggcagactgataaacagaacgtccgc
attatttccggtatcagtgccatccagtacttatgtgcccgtattctgctggatatgaac
gacatttatctcaccagcagccacgggcgtaaacccgattttgactggctgctccggcac
gaaaaaattgcgatggtgacagatgacgttatcggtccgtaccagatagcacaagaaatt
ctggcgcacgggcagccgcgtcgcatggtgattggtgaaaatttatcgcaggaaaatgag
cgaattgtttgtttaaacgcggagcaaatcgcccagcgtggcgatattcattatgacttg
aatgtggtggtgatcctgaatgaaagatga

DBGET integrated database retrieval system