KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1159Help
Entry
XNC1_1159         CDS       T01274                                 

Definition
(GenBank) Sirohydrochlorin cobaltochelatase
  KO
K02190  sirohydrochlorin cobaltochelatase [EC:4.99.1.3]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00860  Porphyrin and chlorophyll metabolism
xne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNC1_1159
Enzymes [BR:xne01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.3  sirohydrochlorin cobaltochelatase
     XNC1_1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiK CbiX
Motif
Other DBs
NCBI-ProteinID: CBJ89230
UniProt: D3V932
Position
1034762..1035553
Genome map
AA seq 263 aa AA seqDB search
MKKALLVISFGTSYPETRRNNIEACEQQLASVFPDRELFRAFTSGMIIRKLRQRDGIHVD
TPHEALTRLHHAGYHDVAVQCLHIIKGDEYEKVLDEVEKFRPCFKRLVLGEPLLSQFDDY
VQLMRALRHQLPRLAENECVVFMGHGTTHHAFSAYACLDHLMSHYYFPARVGAVESYPEL
PLLIKGLKEKGIRKVHLMPLMLVAGDHAINDMASNEKGSWKYQLEKAGITAIPWLQGLGE
NSMIRQMFVDHLTQALGNEEKVW
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcattattggtgataagtttcgggaccagttacccggaaacgcgacgaaat
aatattgaagcctgtgagcaacaattagcgtcagtttttccggacagagaactctttcgg
gcatttacctccggcatgatcatccgcaaattacgccagcgcgatggtatccatgttgac
actccccacgaggcgttaaccagactgcatcacgccggttatcacgacgttgctgtgcaa
tgcctgcatatcatcaaaggcgatgaatatgaaaaggtgttggatgaagtagagaaattc
cgcccctgttttaaacggctggttctgggagaaccgctgctcagtcagtttgatgactat
gtgcaattgatgcgggcactgcgccaccagcttccccgtttggcggagaatgaatgtgtc
gtctttatggggcatggaacaacgcatcatgctttttctgcttacgcctgtctggatcac
ctgatgagccattattactttccggcgcgggtgggggcggtggaaagctatcctgagctt
cctttgcttatcaaaggattaaaagaaaaaggtattcgcaaggttcatctgatgccattg
atgctggtggcaggggatcatgccattaatgatatggcttccaatgaaaaaggctcctgg
aaataccaactggagaaagcgggcataaccgctatcccttggttgcagggattgggcgaa
aactcaatgatccggcagatgtttgtggatcacctgacccaagcactgggtaacgaggag
aaagtctggtga

DBGET integrated database retrieval system