KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1293Help
Entry
XNC1_1293         CDS       T01274                                 

Gene name
pssA
Definition
(GenBank) phosphatidylserine synthase (CDP-diacylglycerol-serine O-phosphatidyltransferase)
  KO
K00998  CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00260  Glycine, serine and threonine metabolism
xne00564  Glycerophospholipid metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Module
xne_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XNC1_1293 (pssA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_1293 (pssA)
Enzymes [BR:xne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     XNC1_1293 (pssA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLDc_2 PLDc DUF1160 ACDC
Motif
Other DBs
NCBI-ProteinID: CBJ89358
UniProt: D3V9X0
Position
complement(1156722..1158077)
Genome map
AA seq 451 aa AA seqDB search
MLSKFKQAKHQQHLAQLPKLPQSVADIETLYQSKVFLSTLLERIANAQKCIYIAALYLEN
DDAGRDILTALYAAKQKHPELDIKILVDWHRAQRGRIGVKTAATNADWYCSMAENHPDVH
IPILGVPVNTREALGVLHLKGFIFDDTVIYSGASINDAYLHRHEKYRYDRYHLLHNAKLA
AIMKQFIDESILTSDAVKNLVNPNLPRSLEIKNLIRQFRASLRNAEYHFENQASNEELAV
TPLVGLGKKNLLNKIICHLMACTENKLVICTPYFNLPAVLVRSISRLLRQGKQVEIIIGD
KTANDFYIPPEEPFRIIGALPYLYEINLRRFTSRLQKFIDSQQLSVRLWKDQDNSYHLKG
IWVDNKWQLITGNNLNPRAWGLDLENAVLIHDPHQEMQSQRSIELDCIRSHTKLINNYQE
LESIQLYPVKVRKLIRRLRRIRVDRLISRIL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccaaatttaaacaggcaaaacaccaacaacaccttgcacaactgcctaaacta
ccgcagtcagttgctgacatagagacactttatcaatccaaagtgttcctcagcacctta
ctggaacgcatcgcaaacgcccagaagtgtatttatattgccgcattatatttagaaaac
gatgatgccgggcgagatattctgactgcattatatgctgccaagcaaaagcatcctgaa
ttagatatcaaaattctggttgattggcaccgtgctcaacgtggtcgtattggcgtaaaa
acagcggcaacaaacgcagattggtactgttctatggctgaaaaccaccctgatgttcac
attccaattttgggtgttccagtgaacacacgtgaagcactgggcgttttacatttaaaa
ggctttatctttgatgatacggtaatttatagcggggccagtattaatgatgcctatctg
caccgccatgaaaaatatcgttatgaccgttatcatttgctgcataatgcaaaacttgca
gccatcatgaaacaatttatagatgaaagtattcttacatcagatgccgtaaaaaattta
gtaaatcctaaccttccgcgtagtcttgagattaaaaatttgatccggcaatttcgtgct
tcattgcgcaatgctgaatatcactttgagaatcaagcctcaaacgaggagttggctgta
acacctctggttggattagggaagaaaaacctgctgaataaaataatctgtcatctgatg
gcttgcactgaaaataagttggtgatctgtaccccatatttcaacttacctgccgtgtta
gtacgatcaatatcacgtttacttcgccaaggaaaacaagttgaaattatcattggagat
aaaaccgccaatgatttttatatccctccggaagaaccatttagaattatcggcgctttg
ccttatctgtatgaaattaacctgcgtcgttttaccagtcggctgcaaaaatttattgat
agccagcagttaagcgtacgtttatggaaagaccaagataattcttatcacttaaaaggg
atctgggttgataataaatggcaactgattactggtaataaccttaatcctcgtgcatgg
ggtttagatctggaaaatgctgttctaattcatgatccccatcaagaaatgcaatcacag
cgttccatagaactggattgcattcgttctcatacaaaacttattaacaactatcaggaa
ttagagagtatccaactctaccctgttaaagttcgcaaactaatacgtcgcttacgccgc
attagagttgatcggttaattagtagaatactgtaa

DBGET integrated database retrieval system