KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1393Help
Entry
XNC1_1393         CDS       T01274                                 

Definition
(GenBank) Pullulanase precursor (Alpha-dextrin endo-1,6-alpha-glucosidase) (Pullulan 6-glucanohydrolase)
  KO
K01200  pullulanase [EC:3.2.1.41]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00500  Starch and sucrose metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Module
xne_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XNC1_1393
Enzymes [BR:xne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.41  pullulanase
     XNC1_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3372 Pullulanase_Ins Pullulanase_N2 CBM_48 Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CBJ89456
UniProt: D3VAM0
Position
1266614..1269421
Genome map
AA seq 935 aa AA seqDB search
MVHNLNQALGEQIYRRTETSDSGPAVSQASAHWVDKHTLLWRDGAGQPIVRLYHNQHAKV
ATNEQGHFTDDYLILTPATLNEATARKFPHLAKWAAFRLPENVDIDRFLTGDLVVLAADE
QGELLSATQVQTAGVLDDRFAEVAETFGYGAQVSDKGVLFRLWAPTAQKVSLVLYNQNKQ
VIAAHTMQRDAASGSWSWQGDKSLVGFYYRYALTVYHPQSRNIERYEVTDPYSYSLSTNS
AYSQVVNLDDAALRPQNWDNLLPPYSQRTKTDIARMTIYEAHIRDLSVADSTISKAWRGK
YLALTDNNSNMFKHLKALSLAGITHMELLPVFDIASVNEFSHQVADLEQSFSHLCQINPA
VKNSRFADYCRSSLTVREVLQQLRHDDNIKNPQVQELNTMVANTDSYNWGYDPFHYSVPE
GSYATDAEGSVRIKEFRTMIQAIKQQLGMNVIMDVVYNHTDAAGPLARTSVLDKIVPWYY
HRLDEITGQVENNTCCHDTAPEHRMFAKLIEDSLVTWAKDYKIDAFRFDLMGYHPKAQIL
SALEKVRTVNPSIYFFGEGWNSGQDDRFEIASQINLRGTGIGTFSDRLRDAVRGGSPFDV
ADDIRISQGIGNGAGTLSNEISRLNADEVCHLLDLTRLGMAGNLVDFVMIDKDGVAKKGH
QIDYKGAVAGYASDPTEVLNYVSKHDNQTLWDIISYKAAYQADLATRVRMQAISLSVVLL
GQGIAFDQHGSELLRSKSFTRDSYNAGDWFNRVSYDYKDNNYDVGMPERSNDGKNYPLIN
RVKNRVQKPGHNELLQMMAFYQELLRLRQFSPLMNLGSGEAIKQRIDFVNVGPHQQIGLL
VMTIDDGKTTSHDRDWRFDGLVVVINAAPWSVTVKELNTKGLKLNDLQHQLGKNSLAAGV
RIKENGEIIMPAWSVAVLVLPQVGLRGKGISVRKK
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggtacacaatttgaatcaggcattaggtgaacaaatttatcgtcgcactgaaacttct
gactcaggaccggcagtttctcaagcctctgcacactgggttgataaacacactttgtta
tggcgggatggggctggtcagcccattgttcgcttatatcacaatcaacacgctaaagta
gcgactaatgaacaaggccattttactgatgattatctgatactcacaccggcaacgttg
aatgaggcaacggcaagaaaattcccccatttggctaaatgggccgcatttcgtctaccg
gaaaatgtagatattgatcggtttctgacaggggatttagtcgttttggcggctgatgag
caaggtgaactgctctcagcgactcaagtccagacggcaggtgtgctggatgaccgtttt
gccgaagttgcggaaacattcgggtatggtgcgcaagtcagtgacaagggcgtgcttttc
cgcctgtgggcacccactgcgcagaaagtgagtctggttctttataatcaaaataaacag
gttatcgctgctcataccatgcagcgcgatgcagcaagtggttcctggtcatggcagggt
gataaatcattggtgggtttctattaccgttatgcgttaacggtataccatcctcagtcc
cgtaatattgaacgttacgaagtcacagatccctattcttatagtttatccaccaattca
gcatatagtcaggttgttaatctggatgatgcagccttgaggccacaaaattgggataat
ctattgccaccctattcgcagcggacaaaaaccgatattgcacgtatgaccatttatgaa
gcacatatccgtgatctttccgttgcagacagtacgatctcaaaagcctggcgtggcaaa
tatctggcactgaccgataataacagcaatatgttcaagcatcttaaggcgttgagcctg
gcaggaataacgcatatggagttattgcctgtgtttgatattgcttccgttaatgagttt
agtcatcaggtggctgatcttgaacagtcttttagccatctgtgccagataaacccagca
gtgaagaatagccgctttgccgattattgccggagttcattgaccgttcgagaagttttg
cagcaattgcgacatgatgacaatatcaagaacccgcaagtgcaagaattaaatactatg
gtggcaaatacagactcctataattggggttacgatccgtttcattattcggtaccggaa
ggttcttatgccactgacgctgaaggttctgtgcgtataaaagaattccgcacaatgata
caggctatcaaacagcaattgggtatgaatgtgattatggatgttgtttacaaccatact
gacgctgccggtcccctggctcgaacatcagtactggataagattgtgccttggtattat
caccgtttggatgaaataacgggtcaggttgaaaacaatacgtgttgtcacgatacggca
ccagaacatcgcatgtttgccaaacttatcgaagactcgctggtaacctgggccaaggat
tataagatagatgcgttccgattcgatttaatgggttatcatccaaaagctcaaatttta
tccgcactggaaaaagtccgtactgttaatccatctatttattttttcggtgaaggctgg
aattcagggcaggatgatcggttcgaaattgcttcacaaattaatcttagaggtacaggt
atcggtactttttctgacagattgcgggatgcagtgcgtggcggttcgccctttgatgtt
gccgatgatattcgtatcagtcaggggatcggcaatggcgcaggaacattatccaatgaa
atttctcggttaaatgcagatgaggtgtgccatttattggatctcacgcgtcttggcatg
gcgggtaatttggttgattttgtcatgatcgataaagacggggtagcgaaaaaagggcat
caaattgattataaaggtgctgttgcaggttatgcctcagatcccactgaagtactgaat
tatgtgtccaagcatgataatcagacgttatgggatatcatcagctataaagcggcatat
caggcggatctggcaacaagggttagaatgcaggcaatttctctctctgttgtccttctc
gggcaaggtatagcttttgaccaacacggctcggagttattgcgctcaaaatcgtttacc
cgtgattcttataatgcaggtgattggtttaatcgtgtgagttatgactacaaggataat
aattatgatgtgggtatgccggagcgcagtaacgatggcaaaaattatccattgattaac
cgtgtgaaaaatagggttcagaaaccaggccacaatgaattattacagatgatggctttt
tatcaggaattattacgcttacgtcaattttcaccattgatgaacctcggcagtggtgaa
gccatcaagcaacgaattgattttgtaaacgttggtccacatcagcagattggattattg
gtgatgacgattgatgacggtaagacgacttctcatgatcgggattggcgatttgatggt
ttggtcgtggtcattaatgctgctccgtggtctgttactgtcaaggaactgaataccaaa
ggattgaagttaaacgatcttcagcatcaattaggtaaaaactctctggctgctggtgta
cgaataaaagaaaatggtgagattatcatgcctgcatggtcagtcgctgtcttggttctg
ccgcaggtaggactccgtggaaagggaatatctgtccgtaagaagtaa

KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4285Help
Entry
XNC1_4285         CDS       T01274                                 

Gene name
malP
Definition
(GenBank) maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00500  Starch and sucrose metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Module
xne_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XNC1_4285 (malP)
Enzymes [BR:xne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     XNC1_4285 (malP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF43
Motif
Other DBs
NCBI-ProteinID: CBJ92307
UniProt: D3VE56
Position
4122280..4124730
Genome map
AA seq 816 aa AA seqDB search
MQRSELDKKQTSDKKNTLGKTEFQTALKRQWQRHFGLNAAQEMTPYQWWHAVSAALSELL
PLSSQQNPVTPSTDNQRHVNYISMEFLIGRLTGNNLLNLGWYDDVQAYLAEYGIILSDLL
EEETDPALGNGGLGRLAACFLDSMATLKQPATGYGLNYQYGLFRQSFEHGQQIEAPDDWK
RDAYPWFSHNAQLKVEVSFGGEIVGTADGHETWLPEFTLIGEARDLPVIGYGNGVTQPLR
LWQASCDNSFDLSLFNDGQFLSAEQQGIEAASLTKVLYPNDNHQKGKRLRLMQQYFQCAC
AVADILRRHQHAGRKIETLPQFEVIQLNDTHPTIAIPEMMRLLLDEHHLSWESAWEITGK
TFAYTNHTLLPEGLERWDESLIQALLPRHHRIILEINQRFKKTVEQTWPDNPQIWEKLAV
IHNNQVRMANLCVVACFAINGVAALHSSLIVTDLFPEYHQLWPAKFHNVTNGVTPRRWLK
QCNPALSALISQTLNREWANDLGLLKQLEPYADDSAFCSAYRTIKQDNKIRLSNYVSKVM
GLKLDPHAIFDVQIKRLHEYKRQHLNLLHILSLYRQIQENPELDIHPRVFLFGAKAAPGY
YLAKNIISAINHAADKINHDPIVRDRIKIALIPDYNVSVAELMIPAADVSEQISTAGKEA
SGTGNMKLALNGALTIGTLDGANVEIAEQVGNDNIFIFGKTVEEAKALLSHGYNPQDILR
HNHHLKSILDALSGGEFSHGDTHAFDLMLHSLIDGGDPYLVLADFASYSHAHKQIDALYR
DTQSWTRSTVLNTARMGKFSSDRTIQDYQKNIWKTQ
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgatccgaacttgataaaaaacaaacctcagataaaaaaaacacattaggaaaa
actgaattccagactgcactcaagcgccagtggcaacgacatttcggccttaatgcagcg
caggaaatgacgccatatcagtggtggcatgccgttagtgccgcgctgtctgaattgctt
ccactttcttcccagcaaaacccagttaccccatccacagataaccagcgtcacgtaaac
tatatctcaatggaatttttgatagggcgcctgacaggcaacaatttactcaatcttggt
tggtacgatgatgtgcaagcttatttagcagaatatggcatcatcttgagtgatctatta
gaagaagaaactgatcctgcattaggtaacgggggattgggacgactggcagcgtgtttt
ctggattcaatggcgacgctcaaacaacctgctacaggctatggcctaaattatcaatac
ggcctattccgccaatcctttgaacacgggcaacaaattgaagcacctgatgactggaaa
agagacgcctatccgtggttcagccataacgcacaattaaaagtcgaagtgagttttggt
ggtgaaatcgtcggaaccgccgatggtcatgaaacgtggctccccgaatttacgcttatt
ggtgaagcccgtgatttacccgtgattggttacggcaatggtgtgactcagccactgcgc
ctatggcaagcctcctgcgataattcctttgatctgtctcttttcaatgatggtcaattt
ttgtctgctgaacaacaaggtatcgaagcggccagcctaactaaagtgctttacccgaat
gataaccatcaaaaaggtaaacgcctgcgcctgatgcaacagtattttcaatgtgcctgt
gccgtggcagatattctgcgccgccaccaacacgcaggacgaaaaatagaaacactgccg
caattcgaagtcatccagcttaatgatactcaccccactatcgccattcctgaaatgatg
cggcttctgcttgatgagcatcacttaagctgggaaagtgcatgggaaattaccgggaaa
acatttgcctatactaatcataccctgttgccagaaggcctggagcggtgggatgaatcc
ctgatccaggcacttctgccacgccatcatcgtattattctcgaaattaaccagcgcttt
aaaaaaaccgtcgagcaaacttggcctgataacccacaaatctgggaaaaattagccgtt
attcacaataaccaagtcagaatggctaatctctgtgttgtcgcctgctttgccatcaac
ggagtcgcagcattacattcctccttgatcgtgacagatctatttccagaatatcaccaa
ttatggccggcaaaattccacaacgtgaccaatggcgtgacgcctcgccgttggctgaaa
cagtgcaatcctgcactttctgcattgattagccagacattaaatcgtgaatgggcaaat
gatctgggtctgctcaaacaacttgagccttatgctgacgacagcgcattctgttcagct
taccgaaccatcaaacaggacaataaaatccgcctgtccaactatgtcagtaaagtcatg
ggactcaaactggacccccatgccatttttgatgtgcagataaagcgcttacatgaatac
aaacgccaacacctgaaccttctccatattctgtcactttatcgacaaattcaggaaaat
ccggaactggatattcatccccgcgtgttcctgtttggcgctaaagctgcaccgggctac
tatctggcaaaaaacatcatttctgcaattaatcatgccgcagataaaatcaatcatgat
ccgattgtccgtgatcgcatcaaaattgcccttattcccgattacaacgtttccgtagca
gaattaatgatcccggcagcagatgtctctgagcaaatctccacggcaggtaaagaagct
tctggtacgggcaatatgaaactggctctaaacggtgcactcaccatcggaacattggat
ggcgcaaatgttgaaatcgctgaacaagttggaaatgacaatatatttatcttcgggaag
acagtagaagaagccaaggctttactgagtcatggctataacccgcaagatattctccgg
cataatcatcacctgaaaagcatactggatgccctatccggaggtgaattcagccatgga
gatacgcacgcatttgacctcatgctgcatagtctgattgatggtggtgatccttattta
gtgctggctgactttgcctcatacagccatgcccataaacaaattgatgctttgtatcga
gatacccaaagctggacacgcagtaccgtgctcaatacagcccgaatggggaaattcagt
tctgaccgtactattcaggattatcaaaaaaatatctggaaaacccaatag

KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4286Help
Entry
XNC1_4286         CDS       T01274                                 

Gene name
malQ
Definition
(GenBank) 4-alpha-glucanotransferase (amylomaltase)
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00500  Starch and sucrose metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Module
xne_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XNC1_4286 (malQ)
Enzymes [BR:xne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     XNC1_4286 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: CBJ92308
UniProt: D3VE57
Position
4124756..4126906
Genome map
AA seq 716 aa AA seqDB search
MENKSLDHLATEAGIASEYINAYGKPQAIPAEIRHRILEAMSMNIPVERPVSSRMPALPN
VKVITQGQTATLPLNEAGNYQWQIYTEQGEIFHGHCQQQFTLPIGLPLGYHTLTLIPEVE
QENRPQQQSIQLIVAPERCYEPKALTQGGKLWGACVQLYTLRSENNWGIGDFGDLKSMLQ
ELAQHGGAFVGLNPLHAIYPAMPENASPYSPSSRHWLNIIYIAVNQVEDFKQSACAQAWW
QSPATQKKLQQAREAEWVDYTTVMTLKMDALRLAYPQFKRLPDDDLRHINFQEFVLKGGT
NLYSQAVYDALHHQLYRENNTYWGWPVWPEKYREPDSEAVKAFCHSHPQEVAFFLWLQWL
ADTQLAECFTTSQNNNMSIGIYRDLAVGVAQGGAETWCNRTIYCTKASIGAPPDILGPRG
QNWGIPPMNPHILKVQAYQPFIELLRSNMRHCSALRIDHVMSLLRLWWIPQGETADKGVY
VYYPVDDLLAILALESQRNHCMVIGEDLGIVPEEIVDKLRERGVYSYKVFYFERNEHGEY
RSPNEYPVQAMATITTHDLPTLRGFWQGRDLTLGESIGLYPDKTLLAELYAERKRCKQAL
LESLDRHGYLSELNPLLKENIPLSLQQTTLQEQAEQTMSASINLGVHCYTAHSNCALLGL
QPEDWQDMANPVNIPGTTTEYPNWRRKLTRTLEAMFADKQINQLLQTVSEYRKQNS
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaaagcctcgatcatttggcaacagaggctggcattgccagcgaatacatt
aatgcctatggcaaaccacaggccattccggctgaaatcaggcaccgaatactggaagcg
atgagcatgaatataccggtcgaaagaccggtttcttctcgtatgcctgctttacctaac
gtaaaagtgattactcaaggacaaacagccaccctgcctctgaatgaggcaggaaattac
caatggcagatatatactgaacaaggcgaaatatttcacggccattgccaacagcaattc
acattgccaatcgggcttcctttgggataccacacgctgacactcataccagaagtggaa
caagaaaaccgtcctcaacaacaatcaatacaacttattgttgctcccgaacgctgctac
gaaccaaaagcgttaacacaaggtggaaaactctggggtgcctgtgttcagctttatact
ctgcgttcagaaaataactggggaattggtgattttggtgacctgaaatctatgctgcaa
gaactggcacaacatggtggcgcctttgtcggcttaaatcctctacatgccatatatcct
gcaatgcccgaaaatgccagcccttacagcccatcttcccgtcactggcttaatatcatt
tatattgccgtcaatcaggtagaagattttaagcagagtgcttgcgcccaagcatggtgg
caatcacccgcaacacagaaaaaactccaacaagcccgtgaagcggaatgggtcgattac
accacagtgatgacactgaaaatggatgcacttcgtctggcttacccacaatttaagcgc
ctacctgacgatgacctgcgacacatcaattttcaggagtttgtacttaaaggggggacc
aacctttactctcaagcagtttatgatgcccttcaccatcaattatacagagaaaataat
acttactggggctggcctgtatggccggaaaaataccgtgagccagacagtgaagcggtt
aaagcattttgccattcacatccacaggaagtcgcgtttttcctttggttgcagtggctg
gccgatacacagcttgccgagtgttttacgacaagccagaataataatatgtcaatcggt
atttatcgtgatctcgctgtaggtgtcgcacaagggggagcagaaacatggtgtaaccga
accatttactgcactaaggcatcaataggtgctccccctgatattttagggccacgagga
caaaactgggggattccgccgatgaatccccatatattgaaagttcaagcctatcaacct
ttcattgaattactccgcagcaatatgcgccattgcagcgcattgcgcattgaccatgtc
atgtcgctactcagactctggtggataccacaaggggaaaccgccgataaaggcgtatat
gtctattatccggttgatgatctgctggcaatcctcgcgctggaaagccaacgtaatcat
tgcatggtgattggcgaagatttaggcattgtaccggaagaaattgtcgataaactacgg
gaacgaggggtgtactcctataaggtattttattttgaacgaaatgagcacggtgaatat
cgttcccccaatgaatatcctgtacaagcgatggcaaccattaccactcatgatttaccc
accttacgcggattctggcaaggcagggatctgacattaggtgagtccattggcttatat
cctgataaaacactgcttgctgagctatatgctgaacgtaaacgttgtaagcaggcattg
ttggaaagtttagatcgacacggttatctatcagaactaaacccgttacttaaggaaaat
atcccgctttccttacaacagaccacattacaggagcaagctgagcagaccatgtcagcc
tctatcaatctcggggtacactgctatacagcccatagcaattgtgccttattaggattg
caacctgaagattggcaggatatggcaaatcccgtcaatattcctgggaccacaacagaa
tatcctaactggcgacgcaaactcacccgtactctggaagccatgtttgcggataaacag
atcaaccaattattgcaaacagtaagcgaataccggaaacaaaactcataa

KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4474Help
Entry
XNC1_4474         CDS       T01274                                 

Gene name
glpE
Definition
(GenBank) thiosulfate:cyanide sulfurtransferase (rhodanese)
  KO
K02439  thiosulfate sulfurtransferase [EC:2.8.1.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00920  Sulfur metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XNC1_4474 (glpE)
Enzymes [BR:xne01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     XNC1_4474 (glpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: CBJ92496
UniProt: D3VF39
Position
complement(4282103..4282426)
Genome map
AA seq 107 aa AA seqDB search
MDHFQTINPDQAYQYWLEKTAVMVDIRDPQSFRTGHVTDAFHLTNETLNNFLQEADFDRP
VMVMCYHGHSSQGAAQYLINMGFETVYSVNGGFDVWQKNYPQAVRTL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggaccattttcaaacaataaaccctgatcaggcttaccagtattggctcgaaaaaacc
gctgtcatggttgatatccgtgatccgcagagtttccgtaccgggcatgtaacagacgca
tttcacctcaccaatgagacactcaataacttcttgcaggaagcggattttgaccgaccc
gttatggtgatgtgctatcacggccatagcagccagggggcagcgcaatatctcatcaat
atgggttttgagaccgtttacagtgtcaatggtggttttgatgtctggcaaaagaactat
cctcaggccgtccgtaccctatga

DBGET integrated database retrieval system