KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1504Help
Entry
XNC1_1504         CDS       T01274                                 

Gene name
gnd
Definition
(GenBank) gluconate-6-phosphate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00030  Pentose phosphate pathway
xne00480  Glutathione metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
Module
xne_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
xne_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XNC1_1504 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XNC1_1504 (gnd)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     XNC1_1504 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     XNC1_1504 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH 3HCDH_N NAD_Gly3P_dh_N ApbA 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBJ89567
UniProt: D3VBC8
Position
1391101..1392507
Genome map
AA seq 468 aa AA seqDB search
MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSSDKTDEVIAENPGKKLVPSYSIEEF
VDSLEKPRRILLMVKAGEATDKTIASLTPHLDKGDILIDGGNTYFQDTIRRNRELSAQGF
NFIGTGVSGGEEGALKGPSIMPGGQKDAYELVAPILKEIAAQVEGEPCVTYIGADGAGHY
VKMVHNGIEYGDMQLIAEAYSLLKNSLNLSNQELSEIFSDWNQGELSSYLIEITADIFRK
QDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGVPVTLITESVFARYISSMKDQRVAASN
VLSGPEVQPFNGDKAEFIEKVRRALYLGKIVSYAQGFQQLKAASDEYNWDLNYGEIAKIF
RAGCIIRAQFLQKITDAYNETPAIANLLLAPYFKQIADEYQQALRDVISYGVQNGIPTPT
FSAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWLD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaacagatcggtgttgtcggtatggcggtaatggggcgcaacctggcgttg
aatattgaaagccgtggttattctgtatctattttcaaccgctccagcgataaaactgat
gaagttattgctgaaaatccagggaaaaaattagttccaagttattccattgaagagttt
gtcgattcgctggaaaagccacgtcgtattctgttgatggttaaggcaggtgaagctacg
gataaaaccattgcatcactgacaccacatttggataagggtgacattctgatcgatggt
ggcaacacctattttcaagatactatccgccgtaatcgtgagttgtctgctcagggtttt
aactttatcggtacgggtgtttccggtggtgaagaaggtgcactgaaggggccttcaatc
atgccgggcggccagaaagacgcttatgaactggtggcccccattctgaaagaaattgca
gctcaggtagagggtgaaccttgtgtcacgtatatcggtgccgatggtgcaggccattat
gtgaagatggttcacaatggtattgaatatggtgatatgcagctgatcgccgaagcctat
tccctgctgaaaaattcactgaacctgagtaatcaagaactgtctgaaatattcagtgac
tggaatcagggtgaactgagtagttatctgatcgaaattacggctgatattttccgtaag
caagatgaagaaggtaaatatctggttgatgtgattctggatgaagctgccaacaaaggg
acaggtaaatggaccagccagagttcgctggatctgggtgtgcctgtgacattaatcact
gaatcggtattcgcacgttatatctcttctatgaaagatcagcgtgtggctgcatctaac
gtgttgtcaggtcctgaagttcagccatttaacggtgacaaggctgaatttatcgagaaa
gttcgtcgtgctttgtacttgggtaagattgtttcttacgcgcaaggcttccagcagttg
aaagccgcgtcagatgaatataactgggatctgaattacggtgaaatcgccaagattttc
cgtgctggttgtattattcgtgcgcaattcctgcaaaaaatcaccgatgcgtacaatgaa
acaccggctatcgctaacttgctgttagcaccttacttcaaacagattgcagatgaatat
cagcaagccctgcgtgatgttatctcttatggtgtacaaaatggtatcccgacaccaaca
ttctctgcggccatttcttattacgacagctaccgttcagcggtattacccgccaatttg
attcaggcacaacgtgactactttggtgcgcatacttacaagcgtactgataaagaaggc
gttttccacactgagtggctggattaa

DBGET integrated database retrieval system