KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1519Help
Entry
XNC1_1519         CDS       T01274                                 

Gene name
hisD
Definition
(GenBank) bifunctional HisD: L-histidinal:NAD+ dehydrogenase; L-histidinol:NAD+ dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00340  Histidine metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01230  Biosynthesis of amino acids
Module
xne_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    XNC1_1519 (hisD)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     XNC1_1519 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CBJ89582
UniProt: D3VBE3
Position
complement(1402513..1403838)
Genome map
AA seq 441 aa AA seqDB search
MKTHFETIVRWQACTPQQQKVLLTRPAVTASEDISYTVKHILETVKTRGDQSLQEFSQRF
DKTTIETLQISANEMDTAARRLTPEIKQAIQQAMNNIRRFHEAQKPVEIDVETVPGVRCQ
QITRPIDSVGLYIPGGSAPLPSTVLMLGIPANIAGCRKIILCSPPPIADEILYAAQLCGI
SEIFQIGGAQAIAAMAFGTESVPKVDKIFGPGNAWVTEAKRQISQCIDGAAIDMPAGPSE
VLVIADHGANPAFTAADLLSQAEHGPDSQVMLVTPDESFARKVIGEIATQLKALPRQQIA
IQALQTSQVIIAEDLDQCVAISNQYGPEHLIIQTRQPEQWVEQITNAGSIFLGDWSPESA
GDYASGTNHVLPTYGYTSTYSSLGLTDFLKRMTVQQLTPQGLRNLASTIEILAQAEQLIA
HKNAVTLRMAALNNSNVGSQS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcatttcgagaccatcgttcgctggcaagcatgcacaccgcaacaacaaaag
gttttgctgacacgtccagccgtcaccgcatccgaggacatttcctatacagttaaacac
attttagaaacagtaaaaacacgcggcgatcagtcattacaagaattcagtcaacgcttc
gataaaacgactattgagactctccagatttcagccaatgaaatggataccgcggctcgc
cgcctcaccccggagattaaacaagctatacagcaggctatgaacaatattcgtcgattc
cacgaagcacaaaaaccggtagaaattgatgttgaaacagtaccgggtgttcgctgccag
caaatcacgcgcccaatagattcggttggactctatattccgggcggctcagcacccttg
ccttccacagtacttatgctgggtataccagccaatattgcgggatgccgtaaaattatc
ctctgttctcctcctcccattgctgatgaaatcctctatgcagcacaattgtgcggaatc
agtgaaattttccagattggcggtgcacaagccattgcagcaatggcatttgggacagaa
tccgttcctaaagtggataaaatttttggcccgggcaacgcatgggtcacagaagccaaa
cgccagatcagccaatgtattgatggtgcagcgatcgacatgcccgcaggcccatccgaa
gtattggttatcgctgatcacggagccaatccggcctttacagcagcagacctgctttct
caagcagaacacggtcctgattctcaggtcatgctggtaacgcctgacgaatcctttgcc
aggaaagtgattggtgaaattgcaactcagcttaaagcattgcctcgccagcagattgca
attcaggcgttacaaaccagtcaggttattattgctgaagatctcgaccaatgcgtagcg
atcagtaaccaatacgggcctgaacatttaatcattcaaacccgccaaccagaacaatgg
gtagaacagatcaccaatgccggatctattttcctcggtgattggtcacctgaatccgca
ggcgattacgcttccggcactaatcacgttctacctacctatggctatacttcaacctat
tccagtctggggctgactgattttctaaaacgaatgactgttcaacaactcacaccacaa
ggattgagaaatctcgcatcaactatcgaaatattggcacaggcagaacagctcatcgca
cacaagaacgccgtgacattacgtatggctgctctcaataactcaaatgtgggctcacaa
agctag

DBGET integrated database retrieval system