KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1937Help
Entry
XNC1_1937         CDS       T01274                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA m1G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xne03009]
    XNC1_1937 (rrmA)
Enzymes [BR:xne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     XNC1_1937 (rrmA)
Ribosome biogenesis [BR:xne03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    XNC1_1937 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_32 PrmA Methyltransf_12 MTS Methyltransf_23 PCMT FtsJ
Motif
Other DBs
NCBI-ProteinID: CBJ89997
UniProt: D3VDT0
Position
complement(1840858..1841520)
Genome map
AA seq 220 aa AA seqDB search
MMQARRAFLHSGHYHALQQKSIELLDEYLPENAEILLDMGCGEGYYTAVVQEQLNLHRKL
AVYGLDVAKVAVRYGARRYPGVNFCVASSHRLPFAERSVDGILRIYAPCKATELARVVKQ
HGIVLTVTPGPRHLYQLKELIYQEVHLHPENREQWDGFELISEKTLGYEMLLNGEQAHNL
LQMTPFAWRASEEVKAHLMSKEQFNCEADFTLKVYQRRIS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagcgagaagggcattcctgcattctggtcattatcatgcgttacaacaaaag
tctattgagctactggatgaatatttacccgaaaatgcggaaatattgctggatatgggg
tgtggtgaaggctattacactgccgtggttcaggagcagttaaacctgcatcgcaagttg
gcggtgtatggattggatgtggcaaaggttgccgtccgttatggtgccaggcgttacccc
ggtgttaatttctgcgtggcatccagccatagattgccttttgcggagcgttctgtggat
ggtattttacggatttatgcaccctgcaaggcaacagaattagctcgggttgtgaaacaa
cacgggatcgttctgacagtaacgccgggcccgcgtcatttgtatcaattgaaagaattg
atttatcaggaagtgcatctgcatcctgaaaaccgtgaacaatgggacggattcgaactc
atttcagagaaaacattgggttatgaaatgttgttgaatggggaacaagctcataattta
ttgcagatgacaccatttgcctggcgggcatcagaggaagttaaagcgcatttgatgtca
aaagaacaatttaattgcgaagccgattttaccttgaaagtgtatcagcgtcgtatttca
taa

DBGET integrated database retrieval system