KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2111Help
Entry
XNC1_2111         CDS       T01274                                 

Gene name
hemA
Definition
(GenBank) glutamyl tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00860  Porphyrin and chlorophyll metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
Module
xne_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
xne_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNC1_2111 (hemA)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     XNC1_2111 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer F420_oxidored OCD_Mu_crystall Sacchrp_dh_NADP YueH
Motif
Other DBs
NCBI-ProteinID: CBJ90171
UniProt: D3VEQ9
Position
2021032..2022294
Genome map
AA seq 420 aa AA seqDB search
MTLLALGINHNTAPVSLREQVVFSPETIGLALDDLLQQPLVQGGVVLSTCNRTELYLSVE
QQGNFKEPLIDWLCRYHQLNPEDLKTSLYWHLDNDAVRHLMRVASGLDSLILGEPQILGQ
VKKAFAESQNCQSLSGELERLFQKSFSVAKRVRTETDIGANAVSVAFAACTLARQIFESL
SQLGILLVGAGETIELVARHLKEHKVRHMMIANRTKERAQVLASEVNAEVISLPDIDTRL
AEADIVISSTASPLPIIGKGMVERALKLRRNQPMLLIDIAVPRDIEPDVEKLSNVYLYSV
DDLQTIIQQNLAQRKAAAIVAEGIVQQESRHFMDWLRSQGAVNTIREYREQAEKIRAEMT
AKALMSIRQGADAEQIINQLTHQLTNRLIHTPTKSLQQAASDGDLERLNLLRDSLGLDHN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgactttattagcactcggtatcaaccataacacagcgcccgtttctttacgtgaacaa
gtggtcttttctcctgagacgataggtctcgcgcttgatgacctgctccagcaaccgctg
gtgcagggcggtgttgtgttgtcaacctgcaatcgcacagaactctatctcagtgttgaa
cagcagggtaattttaaagagccgttgattgactggctatgccgttatcatcagctcaat
cctgaagatctgaaaaccagtctttactggcatctggataatgacgctgtccgtcattta
atgcgggttgcgagcggcttggattccctgatattaggagaaccgcagattttggggcag
gtgaagaaagcctttgccgagtcgcaaaattgccaatcattgtcaggcgaactggaacgc
ttgttccagaaatctttctcggtcgccaagcgggtcagaacagaaaccgatattggcgca
aatgctgtctccgtggcttttgctgcctgcacgcttgcgcggcaaattttcgaatctctt
tctcaattaggcatcctgctggtgggtgcaggggaaaccattgagctggtggcgcgtcac
cttaaagagcacaaagtgcgtcacatgatgattgccaaccgtacgaaagagcgtgcgcag
gtacttgccagcgaagtcaatgcagaagtgatttctttgccggatattgatacccggctg
gccgaagccgatattgtcatcagttctaccgccagccctttgccgatcattggtaaaggg
atggtcgaacgggcgctgaaattacgtcgtaatcagccgatgctcctgatcgatatcgct
gttcctcgtgatatagagccggatgttgaaaaattgagtaatgtttatctgtacagcgtg
gatgatttacagacaatcattcagcagaatcttgctcagcgtaaagccgctgcgatagtt
gcggaaggtatcgtgcaacaagagagccgtcattttatggattggttgcgttctcagggg
gctgttaatacaattcgcgaatatcgggaacaggcggagaaaataagagccgaaatgacg
gcaaaagcgctgatgtccataaggcagggtgctgatgccgaacagattattaaccaattg
actcaccaattgactaatcgtctgatccatacaccaacaaaatcactccaacaggcggcc
agtgatggcgatttggaacgcctgaatctactacgggacagccttgggctggatcataac
taa

DBGET integrated database retrieval system