KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2143Help
Entry
XNC1_2143         CDS       T01274                                 

Gene name
yecP
Definition
(GenBank) putative methyltransferase with S-adenosyl-L-methionine-dependent methyltransferase domain
  KO
K15257  tRNA (mo5U34)-methyltransferase [EC:2.1.1.-]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_2143 (yecP)
Enzymes [BR:xne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     XNC1_2143 (yecP)
Transfer RNA biogenesis [BR:xne03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    XNC1_2143 (yecP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_9 Methyltransf_31 Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 CMAS PCMT DUF4568
Motif
Other DBs
NCBI-ProteinID: CBJ90202
UniProt: D3VEU0
Position
complement(2053335..2054306)
Genome map
AA seq 323 aa AA seqDB search
MIDFGNFYQLIAKNHLNHWLECLPAQLNHWQRTSLHGQFSSWLKVLEKLPAIQPTQLDLK
NGVIAAHEPELADGEKACIHNILKIFMPWRKGPFSLYGIDIDTEWRSDWKWDRVLPYISS
LEGKTILDVGCGSGYHMWRMVGEGAQLVVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLS
IEQLPELHAFDTVFSMGVLYHRRSPLDHLWQLKNQLVSGGELVLESLVIEGDEYQCLIPG
ERYAQMRNVYFIPSAKMLKTWLEKCGFEDVRIVDQTPTTLDEQRKTGWMKTESLADFLDP
SDQCKTIEGYPAPLRAILIARKP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttcggtaacttttatcaattgatcgccaaaaaccatctgaatcattggctg
gaatgtctgcctgcacaattaaaccattggcagagaacgtcactgcatggtcagttcagt
tcatggctaaaagtgttagaaaaactgcctgcaattcaaccgactcagcttgatttgaaa
aatggcgtcattgctgcccacgagccagaactggctgacggggaaaaagcctgtattcac
aatatcctgaaaatatttatgccgtggcgtaaagggcctttttcattgtatggcattgat
atagatactgaatggcgttctgattggaaatgggatcgcgtgcttccatatatttcttct
ttagaaggcaaaactatacttgatgtcggctgcggcagcggttatcacatgtggcgtatg
gtcggtgaaggtgcacaattagttgttggtatcgatccgacccaactttttctgtgtcaa
tttgaagccgtcagaaaattgcttggcaatgaccagcgcgcgcaccttctgcctttgagc
attgagcaattacctgaattacacgcttttgatactgtattttcaatgggagtgctctat
catcgccgctcaccgctcgatcatctgtggcaactgaaaaaccaacttgtttccggtggt
gaactggttctggaaagtctggtcatcgaaggtgatgagtatcaatgcctcattccgggt
gaacgttatgcacaaatgcgcaatgtttactttatcccatccgctaagatgctgaaaact
tggctggagaaatgcggttttgaggatgtcaggattgtcgatcagacgcccacaacgctt
gatgaacaacgtaaaacaggatggatgaaaactgaatcgctggctgatttccttgatcca
agcgatcaatgtaaaacaattgaaggctaccctgcccctctgcgtgcgatccttattgcc
cgcaagccatga

DBGET integrated database retrieval system