KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2438Help
Entry
XNC1_2438         CDS       T01274                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00260  Glycine, serine and threonine metabolism
xne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01130  Biosynthesis of antibiotics
xne01230  Biosynthesis of amino acids
Module
xne_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_2438 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XNC1_2438 (trpA)
Enzymes [BR:xne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XNC1_2438 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NMO
Motif
Other DBs
NCBI-ProteinID: CBJ90497
UniProt: D3VGR1
Position
2368098..2368904
Genome map
AA seq 268 aa AA seqDB search
MVRYEQLFKTLQKQNQGAFVPFVTLGDPSPELSLEIVDTLIAGGADALELGMPFSDPLAD
GPTIQNANLRALSSKVTPTLCFELLEKIRTKHPDTPIGLLVYANLVFHKGIDDFYRHCKD
AGVDSVLVADVPLSESSPFRSAAMKYDIAPIFVCPPNADDALLREIASFGRGYTYLLSRA
GVTGTENRAKLPLTHLINKLKEYHAAPALQGFGISEPAQVTAARQSGASGAISGSAIVKI
IENNLHQPDVMLENLMTFTHAMKNATRL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggtacgttatgagcaactatttaaaacactacaaaaacaaaatcagggtgcgtttgtc
ccttttgtcaccctcggtgatcccagtcctgagctttcattagaaattgtcgatacttta
atcgccggtggagcagatgcacttgaattaggcatgccattttcagatccccttgctgat
ggcccgactattcaaaatgccaatctgcgggcactgtcatccaaagttacaccaacattg
tgttttgagctgctggaaaaaattcggacgaagcatcctgatacaccgattggcctgctg
gtctatgctaatctggtcttccacaaaggcattgatgatttttaccgtcactgtaaagac
gctggtgttgattcagtgttggtggccgatgtaccgttatctgagtcatctccattccgc
tcagccgccatgaaatatgacattgccccgatctttgtttgcccccctaatgctgatgat
gctttactgcgtgaaattgcttcatttgggcggggatacacgtatctcctgtcaagggca
ggagtaaccggtactgaaaaccgtgctaaattgccgttaactcaccttatcaataaactc
aaagagtaccatgcagcccctgctctacaaggttttggcatttcagaacccgcacaggtt
accgcagcacgccaaagtggggcttcgggggcaatttccggctctgccattgtaaaaatt
attgaaaataatctgcatcaacccgatgtcatgctggaaaatttaatgacctttacccat
gccatgaaaaacgccactcgattataa

DBGET integrated database retrieval system